KEGG   Dyadobacter fermentans: Dfer_5180Help
Entry
Dfer_5180         CDS       T00970                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
dfe  Dyadobacter fermentans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dfer_5180
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dfer_5180
   00600 Sphingolipid metabolism
    Dfer_5180
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dfer_5180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6247949..6250051)
Genome map
AA seq 700 aa AA seqDB search
MYNLSIRVAIWAVLVSCNAFAQDSLIIKNRFLERKFTISDNSFHTSRFQHLLTNKDYSRP
GSEEFYFTINGKPASANGANGLFRHVKHSLVRAGNGIQKATVQLAGKPGTEAENVIVDLT
YEVYDELPVVRKQVGITNKGAKAIAIADLEVERLNLVPVSSQQSEMYTNYGSRFAWRPYH
GDHHDAAVFVYNNYAKEGFILGNEAPSILKKTEVYTDHHRISTGMTSLTDHYPFKKWIEP
QETFNSPRTFICLVQSQKWEDAFEGHFADFVRTRMGVKLFERKEIPFTFYNTWRPFYTNI
NDTLVTQLADGLEGTGTDLFIMDAGWENNYGDWEPHPKRFPNGLKPITDHIRKRGMKAGL
WMGLASVDKSSKLYKEHPEWAIYDKNGEPAYLHEEMKNRVTMSLASGYYDYILAKIKRHV
RENDLAYIKLDLAIANSAYVLDYSKKGDYKSEGKNHKDRESSYYAIYERALQLFDDLHKE
FPDLLVDCTYEVWGEYYINDYALIEHADYDWLTNYDDDAPVGPINIRQMAFDRSRAIPTA
TNLIGNQFMDSPYSKFTFLSLASVKPILVGDTRKLPAELKPWYLKWNTWFKMMDKKYQFT
RFSYVSDIFQRPTMSNWDGVYKFNKEKQGGVLFFFRNGSVETMRTFAFPLGEPGSRYRLF
SPEDGKDLGVFTGKELNEKGIPVEISQQFDARVYGIEKIK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacctttccatccgggtcgccatttgggcggtcctcgtttcgtgcaatgcgttt
gcgcaagattcgcttatcattaaaaaccgcttcctggaaagaaaattcacgatcagtgat
aattctttccacacatcccgcttccagcatcttctgacgaacaaagattacagccgccct
ggctcggaagagttttattttacaattaacggcaagcctgcgagtgccaacggcgcgaat
gggttattcaggcacgtaaagcattcactcgtccgggcgggcaacggcatccagaaagcg
actgtccagctggccggcaagcctggtacggaagccgaaaatgtaatagtggatttaacc
tatgaagtctacgacgaactgccggtagtccggaagcaggtcggcattaccaacaagggc
gccaaagccattgccattgccgacctggaagtggagcggctaaacctggtgcccgtttct
tcccagcaaagcgagatgtataccaactacggttcccgtttcgcctggcggccctaccac
ggcgaccaccacgatgcagccgtttttgtgtataataattacgcgaaagaaggctttatc
cttggtaatgaagcacccagcattctcaaaaagaccgaggtatacaccgatcaccaccgc
atttcgaccggtatgacgagcctgacggaccattatccgtttaaaaaatggattgaaccg
caggaaacatttaacagcccacggacattcatctgtctcgtgcagtcccaaaagtgggaa
gatgcattcgaaggccacttcgccgacttcgtacgtacacgcatgggcgtgaaattgttt
gagcggaaggaaattccgttcacattctacaatacgtggcggcctttttatacgaacatc
aacgacacgctcgtaacgcaactagccgacggcctcgaaggcaccggcaccgacctgttt
atcatggacgccggttgggaaaacaattacggcgactgggaaccacatccgaagcgattc
ccgaacggactgaaaccgatcaccgatcatattcgcaagcggggcatgaaagccggcctt
tggatgggcctcgcctcagtggataaaagcagtaaactatacaaagaacatcccgaatgg
gccatttacgataaaaacggtgaaccggcttacctgcacgaggaaatgaagaaccgcgtg
acgatgtcgctcgcatccggctactacgattacattctagccaaaataaagcgccatgta
cgggagaacgatcttgcttacatcaagctcgacctggccatcgccaactctgcatatgtc
cttgattactccaaaaaaggagattacaaatcagaaggaaagaaccataaagaccgcgaa
agctcctactatgccatttatgaaagagcattgcagctttttgacgacctgcacaaggag
tttcccgacctgctcgtggactgtacctacgaagtttggggagaatattatattaatgac
tacgcgctcatcgaacacgccgactacgactggctcaccaactacgacgacgacgcaccc
gtaggcccgatcaacatccgccagatggccttcgaccgcagccgcgccattcccaccgcc
accaacctgatcggcaaccagttcatggattcaccctattccaaattcacatttctctcg
cttgcctccgtgaagcccatcctcgtaggcgacacgcgcaaactccccgccgagctgaaa
ccgtggtacctgaaatggaacacctggttcaaaatgatggacaagaaataccagttcacc
cgattctcgtacgtgtcggacatcttccagcgcccgaccatgagcaactgggacggcgtt
tacaaattcaacaaggaaaaacagggcggcgtgctgttcttcttccggaatggatccgta
gaaacaatgcgcacattcgcattcccgcttggcgagccgggcagtcggtaccggcttttt
tcgccggaagatggcaaggatttgggggtttttacggggaaggaactgaacgaaaaagga
atcccggtggagatttcacaacagtttgacgcgagagtttacggaattgaaaagatcaaa
tag

DBGET integrated database retrieval system