KEGG   Dyadobacter fermentans: Dfer_5226Help
Entry
Dfer_5226         CDS       T00970                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
dfe  Dyadobacter fermentans
Brite
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Dfer_5226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6300484..6303540)
Genome map
AA seq 1018 aa AA seqDB search
MKLQFKEQSFQLDAVQAITDCFLGQPRETNRFTLEKSKELIAKARSASKGQFGMDLEVEE
LIGYRNRQIQITEDQLLENIQQVQRQNDITQSKSLEKPKGVKKGYQFTVEMETGTGKTYT
YIRTMYELHQLYGWSKFIVVVPSIAIREGVYKSFQVMQDHFQERYGHRISPFIYNSSRPQ
DIESFASDSRISVMIINTQAFNAKGKDARRIYMELDQFGTRKPIEIIAQTNPILIIDEPQ
SVEGDKTLESMQDFNPLFTLRYSATHKFEYNKVYRLDALDAYNKKLVKKIQVKGINIKGT
TGTSGYLYLEQIQLSTSRPPLAVLEYEKRNGTGVRRVREKLEKGANLFELSGEMPQYKNW
LLEEVDGYFNRVVINGKIIEAGEAIGDLDEKAFRRIQIRETISSHLKKERELFDKGIKVL
SLFFIDTVDKYRIYDKEGNPGLGEYAQMFEEEYVQLRNEYLDLFYPDYNQYLQRDPAERV
HNGYFSIDKQRKMIDPLVKRGSEETDDISAYDLIMKDKERLLSFDEPTRFIFSHSALKEG
WDNPNVFQICTLKHSDASIRRRQEVGRGMRLSVNKHGIRQDEEAIGEQVHEINKLTIIAS
ESYEEFARGLQSEIAATLKDRPQKATVEFLTGKLLTDEHGNQKRLTFEEAKKLNKYLYKE
DVLDDDDKITDDGRRLVEENNIPLPDQLEAFRDSINQLLRSVYMGEAIKPENDRQSITIQ
TNSNFHKKEFQKLWNKINLKTIYEVQFNSEKLVSDAKIRINADLNISERTYEIRSGELEE
STKEQLQEKNAFQETSRQHKKLNSDVYTNTRYDVVGEIVKHTNLTRKTIVEILKSIDTSK
FLMIRKNPEEFIARTSKLINEVKASLIINNIVYHKVDDRHDAKTVFVNDKSVIRQSEILK
KHVYDFLTTDSQTEARFAEALENSNHVQVYAKLPKSFYITTPVANYSPDWAIVFDKDTIR
HIYFVAETKGTDSDLELREIEKLKIHCAGEHFKAISGQEMKFSKVSNYQQMLEIVQVK
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacaatttaaagagcaaagctttcagttagatgctgttcaggccatcaccgac
tgctttctggggcaacccagagaaacgaaccgttttacactggaaaaaagcaaggaactg
attgccaaagcaaggtcggcaagcaaaggtcagtttggtatggatctggaggtagaggag
ctgatcgggtaccgaaaccggcagatccagattaccgaagatcagttactagagaacatt
cagcaggttcagcggcaaaatgatatcactcaaagtaaatcccttgaaaaacccaaaggt
gtaaaaaagggctatcagttcaccgttgaaatggagactggaacgggtaaaacgtacacc
tatatccgcaccatgtatgaactgcaccagctttatggctggagtaagtttattgtggtt
gttcccagtattgcaatccgtgaaggggtctataagtcgttccaggtgatgcaagaccac
ttccaggagcgatacggacaccgcattagcccatttatttataactcatctcgtccacag
gacattgagagttttgcgtcggatagccgcattagtgtgatgatcatcaatacgcaggca
tttaatgctaaaggtaaagatgcacgtcgtatttatatggaacttgatcagttcggcact
cgaaagcccatcgagattatcgctcagactaatcccattctgattattgatgaaccacaa
tcggtagaaggcgataaaaccttggagagtatgcaggatttcaacccgctttttacactc
cgttattccgctacccataaatttgagtataacaaggtatatcgtctcgatgcactggat
gcctataacaagaagctcgtaaagaaaatccaggtaaaaggtatcaacatcaaaggtact
acgggtaccagtggatatctatatctggaacaaatccagctttctacctcacgtccccca
cttgctgtcttggagtacgaaaagcgtaatgggacgggcgtcaggcgggtacgcgagaaa
cttgaaaaaggagccaacctgtttgaactttccggcgaaatgccccagtataaaaactgg
ctgttagaggaggttgatggctattttaaccgggtggtgatcaatgggaaaataattgaa
gccggagaggctattggcgatctggacgaaaaggcattccggcgaatacaaatccgcgaa
acgatcagttctcatttaaaaaaagaacgagagctttttgacaagggaatcaaggtacta
tcgctcttcttcatagatacagtagataaataccgtatctatgataaggaaggtaatcct
ggtttaggtgaatatgcccagatgtttgaggaggaatacgttcaactaaggaacgaatat
ctagatctgttctatcccgattacaatcaatatctgcaacgtgatccggcagagagggtg
cacaacgggtatttttccattgataagcaacggaaaatgattgaccccttagtaaagcgg
ggaagtgaagagacggatgatatcagcgcttatgacttgattatgaaggataaggagcga
ttgctaagttttgacgaacccacccgcttcattttttcgcattctgccttgaaagaagga
tgggacaatccgaacgtctttcaaatttgtaccctcaagcattcggatgcgtccattcgc
cgccgtcaggaagtagggcgcggtatgcgtctttcggtcaataaacatggcatacggcag
gacgaagaggccattggcgagcaggtacatgaaatcaataaactgacgattatcgcctct
gaaagctatgaagaatttgcccgaggcctgcaatcagaaattgccgcgaccttaaaagat
cgacctcaaaaagcgaccgttgaatttttgactggtaaacttttgactgacgagcatgga
aatcaaaaacgcctgaccttcgaagaagcgaaaaagttgaacaagtatctttataaagag
gatgttttggacgatgacgataaaattacggatgatggacggaggttggttgaagaaaac
aatatcccccttcctgaccaattggaagcatttcgggatagcataaatcaattgctacga
tccgtttatatgggcgaagccatcaaacctgagaatgaccggcaaagcattacaattcag
acgaacagtaactttcataagaaggaatttcagaagctttggaataagatcaacctgaaa
accatttatgaagtacagtttaactcggaaaagctggtttctgatgccaaaattcggata
aacgcagatttgaatatttcggagcgtacgtatgaaatccgcagcggagagctggaggag
agtacgaaagagcagttgcaggaaaagaatgcctttcaggagacttcccgccaacacaag
aagctcaattccgatgtctatacaaatacaagatatgatgtggttggagagattgtcaaa
cataccaaccttacccgaaaaaccatcgtcgagatattaaagagcattgacacgagcaag
ttcctgatgatccggaaaaatccagaggagtttatagcccgaaccagcaagctaatcaat
gaagttaaggccagtctgatcatcaataacatcgtctatcacaaagttgatgacaggcat
gatgctaaaaccgtatttgtgaatgacaaatccgttattcggcagtcagaaatattgaaa
aagcatgtttatgactttctgactactgattcacaaaccgaagcacgttttgccgaagca
ttggaaaacagcaaccatgttcaggtatacgctaagcttccgaaaagtttttacattacc
acgcctgtcgctaattatagtcctgactgggcgattgtgtttgataaggacactatccgc
cacatctattttgtagcagaaaccaagggtacggattcagacctagagctacgcgagata
gaaaagctgaaaatccattgtgccggggaacatttcaaagcaatcagtggacaagagatg
aagttttcaaaagtcagcaactaccagcaaatgctggaaatagtgcaagtgaaataa

DBGET integrated database retrieval system