KEGG   Dyadobacter fermentans: Dfer_5368Help
Entry
Dfer_5368         CDS       T00970                                 

Definition
sigma 54 interacting domain-containing protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dfe  Dyadobacter fermentans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dfe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6490056..6491900
Genome map
AA seq 614 aa AA seqDB search
MEKNLYPFAAIVGQDELKKALLLCAVNPGIGGVLIKGEKGTAKSTVVRGLAAIMPPQPLS
GEPVPFVDMPLGASEDRVLGSLDIEAVLSSKTRKLLPGLLASAHEGILYIDEVNLLADHL
VDVLLDVAASGTNTVQREGLSVSHPAKFVLIGTMNPEEGNLRPQFLDRFGLMVEVGAPAD
VQARTEVVRRRIAFERNPEGFVNQWIDNQEIIKAQISRAMQLLPLVQMPDGLLKMISQLC
IEWGVSSLRADIVLYKTAVTMAALHGRTLVTPDDIRESATLVLTHRKGKKALSPNSQQPN
ERPASGDENPQNQKSQTPEAPDKTQNGQQDGECGEGNCESEGSERIANIDFGMTVPELTK
KPASAAPDVANGRDVRARQTAKGAAIRAVRSETASDIAMTDTILHALTRNPDDLTIGKAD
LHQKVRSGKAGRLILFVVDSSGSMAAGKRMEAVKGSVMKLLEDAYQKRNMVAVIAFRGVE
ATVLLEPTRSTGLAEQALEQLPTGGRTPLPHALEMAEKMLASFAGRDTMEPLLVILSDGK
ANVPLPGSGGDAWRQSLQLAQNLHCDALVLDTESGYVRYGKARELATALGAEYRSLQELS
ADEITDTIAKRIVI
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaacttgtacccgtttgccgcgatcgtcgggcaggatgaactgaaaaaggca
ttgctgctctgcgccgtcaatccgggcattggcggggtgctgatcaaaggcgaaaaaggc
acggctaaaagtactgtggtgcgcggactggcggcgataatgcccccgcagcctctcagc
ggcgaaccggtgccgtttgtggacatgccgctgggcgcttccgaagaccgtgtgctggga
agtctggatattgaggctgttctttccagcaaaacgcgcaaactgctccccgggctgctc
gctagtgcgcacgagggtattttatatatcgatgaagtgaacctcctggccgatcacctg
gtggatgtgctgctggatgtggcagcttcgggcacgaataccgtgcagcgggaggggctg
tcggtgagccatccagcgaagtttgtgctgatcggtacgatgaaccccgaggaaggcaat
ctgcgaccgcagtttctcgaccggttcggattgatggtggaagtaggcgcacctgccgac
gtgcaggcaaggacggaagtggtgcgaagacggatcgcttttgagcgtaatccggaaggt
tttgttaatcaatggattgacaatcaagaaattattaaagcgcagattagcagggcaatg
cagctgctgccactggtgcaaatgccggacggattgctgaaaatgatcagccagctctgc
attgaatggggcgtgagcagtctccgggcggatattgtgctatacaaaacggccgtcaca
atggcagcgctgcacggtcggacgctcgtcacaccggacgacatccgcgagtcggccacg
ctcgtgctcacgcaccggaagggcaaaaaagcactatcccccaatagccagcaacccaat
gaacgcccggcgagcggcgacgaaaacccacaaaatcaaaaaagccagacacccgaagca
cctgataaaacacaaaacgggcaacaagacggtgaatgcggtgaaggaaattgtgaaagc
gagggtagcgaacgcatcgcgaatattgattttggaatgaccgtaccagaattgacgaag
aagcccgctagcgccgctccggatgtggcaaacggacgggatgtacgcgctcgtcagacc
gcaaaaggtgctgcgatcagggcggtaaggagtgaaacagcgagcgatatcgccatgacg
gacaccatcctgcacgcccttacacgcaacccggacgatctcacaatcggcaaagcggat
ttgcaccagaaagtccgtagcggaaaggcagggcggctgatacttttcgtcgtggattcg
tcgggttcgatggcggcgggcaaacgcatggaagccgtaaaaggcagcgtaatgaagctc
ctggaagatgcttatcaaaagcgtaacatggtggcggtgattgccttccggggtgtggaa
gcgacagttttgctcgaacctacccgcagcaccggcctggctgagcaggcattggagcaa
ctcccgaccggcggccgtacgcccctgccgcatgcattggaaatggcggagaaaatgctc
gcatcgtttgcaggacgcgatacgatggagcccttgctggtaatcctgagcgacggcaaa
gccaatgtacctctgcccggctcgggtggcgatgcatggcggcagtcgctgcaactggct
caaaatctgcattgtgacgcactcgtgcttgacaccgagagcggctatgtacgctacggg
aaagcgcgggagctggccacggcgctgggcgcggagtaccggtcgttgcaggagctttcg
gctgatgaaattacagatactattgcaaagcggatcgttatttga

DBGET integrated database retrieval system