KEGG   Dyadobacter fermentans: Dfer_5601Help
Entry
Dfer_5601         CDS       T00970                                 

Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dfe  Dyadobacter fermentans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dfe00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dfe00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6729981..6731498
Genome map
AA seq 505 aa AA seqDB search
MVRVFRQPFTGMAWLFLYIMKRNVIATFTWLGFALMSCSAETPEESNNPAPADTTAANKV
AVWVTNGTQGKLLKSEQPLSIVKAGTVSPAANLINIDFSTKLQEMEGFGAALTGSSAYLI
QQKLNASQRENLLKDLFDPNTGIGMSYLRVTMGASDFSLEDFTYNDLPAGQTDAALSKFS
IAKDQADLIPVLKSVLALQPSIRIMATPWSAPAWMKTSGKLAGGSLKPEWYGAYAQYFKK
YLDAYQKEGITIDAISVQNEPLHEAAYPSMGMDSAAQGNFIKNHLGPLFEANAIRTKILL
YDHNWDRPGYPISILNDPQASRYVAGSAFHAYGGNVSAMSEVHDRFPDKGLYFTEISGGR
WATNFSDNLKWNMSNIFIGTANNWSKNALLWNIALDENDGPKNKGCDNCRGVVTIASNGS
ITKNVEYYTIAHMSKFVRPGAFRVQTDRLSASSQLEHVAFLNPDGSKVLVILNQGADNRK
FTVAVGKNQYSYTIDPNAVATLVWK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggtccgggttttccggcagccgttcactggcatggcctggctttttttatatatcatg
aaaagaaatgtgattgcaacgttcacctggctgggttttgcgttgatgagctgctcagcg
gaaacaccggaagaaagcaataatcccgctcctgcggacaccacagcggctaacaaagtg
gccgtgtgggtaacgaacggcacgcagggcaagctgctgaaaagcgagcagccgctctcc
atcgtgaaagcggggacggtttcgcccgccgccaacctgattaatattgatttttccacc
aaattgcaagaaatggaaggcttcggtgcagcgctcacgggctcatcggcctatctcatc
cagcaaaagctcaatgcctcgcagcgcgaaaacctgctgaaagacctttttgatcctaac
accggcatcgggatgagctatttgcgcgttacgatgggcgcgtcggatttttccctggaa
gattttacgtacaacgacctgcccgcaggacaaacggacgcggctttaagcaaattctcc
atcgcaaaagatcaggcggacctcattcccgtcctcaaatccgtgctggccttgcagcct
tcgatccgcattatggcaacgccgtggtcggcgccggcgtggatgaaaaccagcggaaaa
ctggccggcggcagcctcaaaccggaatggtatggtgcttatgcccagtattttaaaaaa
tacctcgacgcttaccagaaagaaggcataacgatcgacgccatttcggtgcagaacgaa
ccgttgcacgaggcggcatatccttccatgggcatggattcggcggcgcaggggaatttc
attaagaaccacctgggcccgttgttcgaggccaatgcgatccggacgaagatcctgctt
tacgatcataactgggacaggccggggtatcccatctcgatcctcaacgacccgcaggcg
agccggtacgtggccggatcggcatttcatgcttatggcggcaatgtgtcggcgatgagt
gaagtgcatgaccgctttcccgacaagggcctgtattttaccgaaatatcaggcggccgc
tgggcgaccaatttttccgataatctgaaatggaacatgtcgaatatattcatcggcacg
gccaacaactggtcgaaaaacgcgcttttgtggaacattgcgctggatgagaatgatggc
cccaaaaacaagggctgcgacaattgccgcggcgtggtaaccatcgcttccaatggcagt
attaccaaaaatgtggagtactacacgatcgcgcacatgtcgaaattcgtgcgtccgggc
gcattccgcgtgcaaacggaccggctgagcgcatcgagccaattggaacacgtcgcattc
ctgaaccccgacggctcaaaagtgctggttatactgaaccagggcgccgataaccggaag
tttacggtggccgttggtaaaaatcagtacagctacaccattgatccaaatgcggtggca
acgctggtttggaaataa

DBGET integrated database retrieval system