KEGG   Dyadobacter fermentans: Dfer_5601Help
Entry
Dfer_5601         CDS       T00970                                 

Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dfe  Dyadobacter fermentans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dfer_5601
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dfer_5601
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dfer_5601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6729981..6731498
Genome map
AA seq 505 aa AA seqDB search
MVRVFRQPFTGMAWLFLYIMKRNVIATFTWLGFALMSCSAETPEESNNPAPADTTAANKV
AVWVTNGTQGKLLKSEQPLSIVKAGTVSPAANLINIDFSTKLQEMEGFGAALTGSSAYLI
QQKLNASQRENLLKDLFDPNTGIGMSYLRVTMGASDFSLEDFTYNDLPAGQTDAALSKFS
IAKDQADLIPVLKSVLALQPSIRIMATPWSAPAWMKTSGKLAGGSLKPEWYGAYAQYFKK
YLDAYQKEGITIDAISVQNEPLHEAAYPSMGMDSAAQGNFIKNHLGPLFEANAIRTKILL
YDHNWDRPGYPISILNDPQASRYVAGSAFHAYGGNVSAMSEVHDRFPDKGLYFTEISGGR
WATNFSDNLKWNMSNIFIGTANNWSKNALLWNIALDENDGPKNKGCDNCRGVVTIASNGS
ITKNVEYYTIAHMSKFVRPGAFRVQTDRLSASSQLEHVAFLNPDGSKVLVILNQGADNRK
FTVAVGKNQYSYTIDPNAVATLVWK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggtccgggttttccggcagccgttcactggcatggcctggctttttttatatatcatg
aaaagaaatgtgattgcaacgttcacctggctgggttttgcgttgatgagctgctcagcg
gaaacaccggaagaaagcaataatcccgctcctgcggacaccacagcggctaacaaagtg
gccgtgtgggtaacgaacggcacgcagggcaagctgctgaaaagcgagcagccgctctcc
atcgtgaaagcggggacggtttcgcccgccgccaacctgattaatattgatttttccacc
aaattgcaagaaatggaaggcttcggtgcagcgctcacgggctcatcggcctatctcatc
cagcaaaagctcaatgcctcgcagcgcgaaaacctgctgaaagacctttttgatcctaac
accggcatcgggatgagctatttgcgcgttacgatgggcgcgtcggatttttccctggaa
gattttacgtacaacgacctgcccgcaggacaaacggacgcggctttaagcaaattctcc
atcgcaaaagatcaggcggacctcattcccgtcctcaaatccgtgctggccttgcagcct
tcgatccgcattatggcaacgccgtggtcggcgccggcgtggatgaaaaccagcggaaaa
ctggccggcggcagcctcaaaccggaatggtatggtgcttatgcccagtattttaaaaaa
tacctcgacgcttaccagaaagaaggcataacgatcgacgccatttcggtgcagaacgaa
ccgttgcacgaggcggcatatccttccatgggcatggattcggcggcgcaggggaatttc
attaagaaccacctgggcccgttgttcgaggccaatgcgatccggacgaagatcctgctt
tacgatcataactgggacaggccggggtatcccatctcgatcctcaacgacccgcaggcg
agccggtacgtggccggatcggcatttcatgcttatggcggcaatgtgtcggcgatgagt
gaagtgcatgaccgctttcccgacaagggcctgtattttaccgaaatatcaggcggccgc
tgggcgaccaatttttccgataatctgaaatggaacatgtcgaatatattcatcggcacg
gccaacaactggtcgaaaaacgcgcttttgtggaacattgcgctggatgagaatgatggc
cccaaaaacaagggctgcgacaattgccgcggcgtggtaaccatcgcttccaatggcagt
attaccaaaaatgtggagtactacacgatcgcgcacatgtcgaaattcgtgcgtccgggc
gcattccgcgtgcaaacggaccggctgagcgcatcgagccaattggaacacgtcgcattc
ctgaaccccgacggctcaaaagtgctggttatactgaaccagggcgccgataaccggaag
tttacggtggccgttggtaaaaatcagtacagctacaccattgatccaaatgcggtggca
acgctggtttggaaataa

DBGET integrated database retrieval system