KEGG   Dyadobacter fermentans: Dfer_5625Help
Entry
Dfer_5625         CDS       T00970                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00010  Glycolysis / Gluconeogenesis
dfe00020  Citrate cycle (TCA cycle)
dfe00620  Pyruvate metabolism
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01120  Microbial metabolism in diverse environments
dfe01130  Biosynthesis of antibiotics
dfe01200  Carbon metabolism
Module
dfe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dfer_5625
   00020 Citrate cycle (TCA cycle)
    Dfer_5625
   00620 Pyruvate metabolism
    Dfer_5625
Enzymes [BR:dfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dfer_5625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PYNP_C Biotin_lipoyl_2 DUF2118 GCV_H CAT
Motif
Other DBs
NCBI-ProteinID: ACT96815
UniProt: C6VWR5
Position
complement(6761575..6763269)
Genome map
AA seq 564 aa AA seqDB search
MAEVIRMPKMSDTMEEGVIAEWHKKVGDKIKSGEVIAEVETDKATMDLESYWDGTLLYIG
VKKGDAVPIDGIMAIVGNEGEDYQSLLDGASNGNGAATAPAKEESAPAPKEEAPAVETID
AQSAPAAKPAPAPASTEKINAAVVRMPKMSDTMEEGTLVSWQKKVGDKVKSGDILAEVET
DKATMELEAYEDGTLLFVGIKEGEAVPVDAIIAVIGEEGANVEALLARENGEAPAEAEAA
PAQAATSAPTVNGSDKAVSVADSGDRVKASPLAKRLADEKGINLSEVSGSGDNGRIVKRD
VDEFKPAAQASAPAAAPAQTAPAAKAEAAPAAAAPASGDFTDTPISQMRKTIARRLSESL
FTAPHFYVTMEINMDKAMALRPQLNEVATAKISFNDMVIKACAVALKKHPAVNSAWLGDK
IRKYNYVNIGVAVAVDEGLLVPVIREADKKTLSAISGEVKDLAGKAKDKKLQPKDWEGNT
FSVSNLGMFGVDEFTAIINPPDSCILAIGAIKKVAAFKEDGTVYPTNIMKVTLSADHRVV
DGATAAQFLLTVKKLLEEPMSMLV
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattcgtatgcccaaaatgagcgacaccatggaagaaggtgttatcgcg
gaatggcacaaaaaagtaggcgataaaattaaatccggtgaagtgattgctgaggtggaa
accgacaaggcgactatggacctggaatcttactgggacggtacccttctttacatcggc
gtgaaaaaaggcgatgcagtacctatcgacggtatcatggcgatcgtaggcaacgaaggc
gaagactaccagtcgctgctcgacggtgccagcaatggcaacggcgctgctaccgcacct
gccaaagaagagtcggcacccgctcctaaggaagaagctcccgctgtggaaaccattgac
gcacaaagcgcgccggcagcgaaacctgcacccgctcctgcatctaccgagaaaattaat
gctgcggtagtgcgtatgccgaaaatgagcgataccatggaagaaggtacgctggtttca
tggcagaaaaaagtaggtgataaagtaaaatcaggcgatatcctggccgaagtcgaaacc
gacaaggctacgatggagctcgaagcatacgaggacggcacattgcttttcgtaggcatt
aaagaaggcgaagcagttcctgtggacgcgatcatcgccgtaatcggtgaagaaggtgcg
aatgtagaagcattgctggcccgcgaaaacggcgaagcgcctgcggaagcggaagcagct
ccggcacaagcagccacttcggcaccgactgtaaatggctccgataaagccgtttcagta
gctgactccggtgaccgtgtgaaagcatcgcccctggcgaaacgcctggccgacgaaaaa
ggcattaacctgagcgaagtgtcaggaagcggcgacaacggacgcatcgtaaaacgcgat
gttgacgaatttaagcctgccgcacaggcatcggctcctgctgctgcccccgcacaaact
gctccggctgccaaagccgaggctgctcccgctgcggctgcccctgcatcaggcgacttt
accgatacgccaatctcgcaaatgcgtaaaaccattgcacgccgcctgagcgaaagcttg
ttcactgcgcctcacttctacgtgaccatggaaatcaacatggacaaggcaatggcactc
cgcccgcagctgaacgaagtggctaccgcgaagatctcattcaacgacatggtgatcaaa
gcatgcgccgtggcattgaaaaaacatcctgccgtaaactccgcgtggctgggtgacaaa
atccggaaatacaattatgtcaacatcggtgtagccgtggcagtggacgaaggtttgctc
gtgccggtaatccgcgaggctgacaagaaaacgctttctgccatttcaggcgaagtaaaa
gacctggccggcaaagcgaaagataaaaaactgcaaccgaaagactgggaaggcaacaca
ttctcggtgtcgaacctcggaatgttcggtgtagacgaatttacagcgatcatcaacccg
ccggattcctgtatcctggcgatcggtgcgatcaagaaagtggctgctttcaaggaagat
ggaacggtttacccgaccaacatcatgaaagtgacgctttccgccgaccaccgcgtggta
gatggcgcaactgctgcccagttccttttgacagtgaaaaaactgttggaagagccaatg
agcatgctggtttaa

DBGET integrated database retrieval system