KEGG   Dyadobacter fermentans: Dfer_5625Help
Entry
Dfer_5625         CDS       T00970                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dfe  Dyadobacter fermentans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dfer_5625
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dfer_5625
   00020 Citrate cycle (TCA cycle)
    Dfer_5625
   00620 Pyruvate metabolism
    Dfer_5625
Enzymes [BR:dfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dfer_5625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6761575..6763269)
Genome map
AA seq 564 aa AA seqDB search
MAEVIRMPKMSDTMEEGVIAEWHKKVGDKIKSGEVIAEVETDKATMDLESYWDGTLLYIG
VKKGDAVPIDGIMAIVGNEGEDYQSLLDGASNGNGAATAPAKEESAPAPKEEAPAVETID
AQSAPAAKPAPAPASTEKINAAVVRMPKMSDTMEEGTLVSWQKKVGDKVKSGDILAEVET
DKATMELEAYEDGTLLFVGIKEGEAVPVDAIIAVIGEEGANVEALLARENGEAPAEAEAA
PAQAATSAPTVNGSDKAVSVADSGDRVKASPLAKRLADEKGINLSEVSGSGDNGRIVKRD
VDEFKPAAQASAPAAAPAQTAPAAKAEAAPAAAAPASGDFTDTPISQMRKTIARRLSESL
FTAPHFYVTMEINMDKAMALRPQLNEVATAKISFNDMVIKACAVALKKHPAVNSAWLGDK
IRKYNYVNIGVAVAVDEGLLVPVIREADKKTLSAISGEVKDLAGKAKDKKLQPKDWEGNT
FSVSNLGMFGVDEFTAIINPPDSCILAIGAIKKVAAFKEDGTVYPTNIMKVTLSADHRVV
DGATAAQFLLTVKKLLEEPMSMLV
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattcgtatgcccaaaatgagcgacaccatggaagaaggtgttatcgcg
gaatggcacaaaaaagtaggcgataaaattaaatccggtgaagtgattgctgaggtggaa
accgacaaggcgactatggacctggaatcttactgggacggtacccttctttacatcggc
gtgaaaaaaggcgatgcagtacctatcgacggtatcatggcgatcgtaggcaacgaaggc
gaagactaccagtcgctgctcgacggtgccagcaatggcaacggcgctgctaccgcacct
gccaaagaagagtcggcacccgctcctaaggaagaagctcccgctgtggaaaccattgac
gcacaaagcgcgccggcagcgaaacctgcacccgctcctgcatctaccgagaaaattaat
gctgcggtagtgcgtatgccgaaaatgagcgataccatggaagaaggtacgctggtttca
tggcagaaaaaagtaggtgataaagtaaaatcaggcgatatcctggccgaagtcgaaacc
gacaaggctacgatggagctcgaagcatacgaggacggcacattgcttttcgtaggcatt
aaagaaggcgaagcagttcctgtggacgcgatcatcgccgtaatcggtgaagaaggtgcg
aatgtagaagcattgctggcccgcgaaaacggcgaagcgcctgcggaagcggaagcagct
ccggcacaagcagccacttcggcaccgactgtaaatggctccgataaagccgtttcagta
gctgactccggtgaccgtgtgaaagcatcgcccctggcgaaacgcctggccgacgaaaaa
ggcattaacctgagcgaagtgtcaggaagcggcgacaacggacgcatcgtaaaacgcgat
gttgacgaatttaagcctgccgcacaggcatcggctcctgctgctgcccccgcacaaact
gctccggctgccaaagccgaggctgctcccgctgcggctgcccctgcatcaggcgacttt
accgatacgccaatctcgcaaatgcgtaaaaccattgcacgccgcctgagcgaaagcttg
ttcactgcgcctcacttctacgtgaccatggaaatcaacatggacaaggcaatggcactc
cgcccgcagctgaacgaagtggctaccgcgaagatctcattcaacgacatggtgatcaaa
gcatgcgccgtggcattgaaaaaacatcctgccgtaaactccgcgtggctgggtgacaaa
atccggaaatacaattatgtcaacatcggtgtagccgtggcagtggacgaaggtttgctc
gtgccggtaatccgcgaggctgacaagaaaacgctttctgccatttcaggcgaagtaaaa
gacctggccggcaaagcgaaagataaaaaactgcaaccgaaagactgggaaggcaacaca
ttctcggtgtcgaacctcggaatgttcggtgtagacgaatttacagcgatcatcaacccg
ccggattcctgtatcctggcgatcggtgcgatcaagaaagtggctgctttcaaggaagat
ggaacggtttacccgaccaacatcatgaaagtgacgctttccgccgaccaccgcgtggta
gatggcgcaactgctgcccagttccttttgacagtgaaaaaactgttggaagagccaatg
agcatgctggtttaa

DBGET integrated database retrieval system