KEGG   Dyadobacter fermentans: Dfer_5683Help
Entry
Dfer_5683         CDS       T00970                                 

Definition
cellulose 1,4-beta-cellobiosidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dfe  Dyadobacter fermentans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dfer_5683
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Dfer_5683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6830166..6831914
Genome map
AA seq 582 aa AA seqDB search
MKFVPHLAAFLAAVGLSLSSSHAQQHSDAIRLNQIGFYPAAPKVAVVAGDGFEAFEVKDA
KSGKTVLKGMLGPVRTSQHSGKHTRVADFSQLRKPGNYTIDVPGLGKSAPFSVGARVHRE
VAEASLKGFYFQRASTELPEKYAGKWARKAGHPDDKVLIHASAVSDGRPENTLISSTRGW
YDAGDYNKYIVNSGITMGTLLSLYEDFPLFFEDFNINIPESNNGVPDLLDEVAWNLRWML
TMQDPADGGVYHKLTNPRFDGMIMPDAAKNPRYVVQKGTAATLDFVAVMAQASRVFKNFD
NKFPGLADSCTTAAVRGWQWAGKNPAVLYEQGEMNKQFDPDVVTGAYGDRSVKDEWIWAA
SEMYAMTGKPEYIEKVDLELNQPLALPTWGNVKTLGYYTLVRFGDKLKLPAELAAPLRKS
IVTYADGLISGLEKQPYHTVMGKVAQDYSWGSSSVAANQGIALMYAYRITKDLHHLHGAL
GNLDYLLGRNATGYCFLTGFGSKRVMHPHHRLSIADGVVDPLPGLLSGGPNPGQQDKCAG
YPNKFPDESFIDHDCSYASNEIAINWNAPMVYLAAALEASMK
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgtcccgcatttggccgcattcctggcggccgttggtttgtcattgtcctcc
tcgcacgcacagcagcattcggatgcgatccggttaaatcagatcggtttttaccctgcg
gcgcccaaggtcgcggtcgttgccggtgacggtttcgaggcatttgaggtgaaggatgcc
aaatccgggaaaacagtgctgaaaggcatgcttggaccagtacggaccagccagcattct
ggaaaacatacgcgcgtggccgatttcagccagcttcgcaaaccgggcaactacacgatc
gacgtgccgggtcttgggaaatccgcgccatttagcgtgggtgcccgcgtgcaccgcgaa
gtggccgaggcatcgcttaaagggttttacttccagcgggcctccaccgaattgcccgag
aaatacgccggtaaatgggcccgcaaagcaggtcatcccgacgataaggtgctgatccac
gcctcggctgtgtccgacggacggcccgaaaataccttaatatcctccacccggggctgg
tatgatgcgggcgattacaacaagtatattgtgaattccggcattactatgggcactttg
ctgtcgttgtacgaagacttcccactctttttcgaagattttaatatcaatatccccgaa
agcaacaatggcgttcccgatctgctcgatgaagtggcctggaacctgcgctggatgctc
accatgcaggacccggccgatggcggtgtgtaccacaagctgaccaacccgcgcttcgac
ggcatgattatgcccgacgccgccaaaaatccgcggtacgtcgtccagaagggcaccgcg
gccacgcttgacttcgtggcagtaatggcgcaggcctcgcgggtatttaaaaatttcgac
aacaaattccccgggctcgctgactcgtgtaccactgcggccgtgcgaggctggcaatgg
gccgggaaaaatcccgccgtgctgtatgagcagggcgaaatgaacaagcaattcgatccc
gatgtggtgactggcgcttacggagaccgttcggtaaaggatgaatggatatgggcagcc
agcgaaatgtacgccatgacgggcaaacccgaatacattgaaaaagtcgatttggagctg
aaccagccactggcactgcctacctggggcaatgtgaagacgctcggatattacacactg
gttcgctttggcgacaagctgaaactgccggccgagctggccgcgccgctgcggaagagc
attgtgacctacgcggatggccttatttccggactggaaaagcagccttaccacaccgta
atgggcaaagtggctcaggattattcctggggtagcagctcggtggccgccaaccagggc
attgcactcatgtacgcctaccggatcacgaaggatctgcatcacttgcacggcgcgctg
ggtaacctagattacctgcttggaagaaacgccaccggctattgcttcctcacaggcttc
ggcagcaagcgcgttatgcacccgcaccaccgcctttccattgccgacggcgtcgtcgat
cccttgccggggttgctttcgggcgggccaaatcctggtcagcaggacaaatgcgctgga
tatcccaacaagtttcccgacgaatctttcatagaccatgattgctcgtacgcttccaac
gagatcgccatcaactggaatgcaccgatggtgtacctggcggccgcattggaagcgtcg
atgaaatag

DBGET integrated database retrieval system