KEGG   Dyadobacter fermentans: Dfer_5694Help
Entry
Dfer_5694         CDS       T00970                                 

Definition
(GenBank) Xylose isomerase domain protein TIM barrel
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00562  Inositol phosphate metabolism
dfe01100  Metabolic pathways
dfe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dfer_5694
Enzymes [BR:dfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     Dfer_5694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DUF3896
Motif
Other DBs
NCBI-ProteinID: ACT96883
UniProt: C6VWY3
Position
complement(6840887..6841789)
Genome map
AA seq 300 aa AA seqDB search
MNFENIQLGVAPINWTNDDMPELGGENTFEQCVSEMALAGFTGCEVGNKFPRDVNVLKKA
LELRGLQICNQWNSYELTTKSFTENRENFTKLLDFLEVMGARVIGGGETGNSCQGQMNVP
VFEGKGMLSTREEWASFTYGLDELGKIARDRGMKLAFHHHMGTCVQTMEETDRLLNETNP
DYVFLNYDCGHFHFAGEDPVAALKKYIGRTAHIHLKDVRPTILQRVHDERLSFLTAVKNG
VFTVPGDPEGCIDFPSLFAIIRESDYAGWIVLEAEQDPAKANPLEYAIIARNFFRSLTGI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgaaaacattcaactgggcgttgctcctattaactggaccaacgacgatatg
ccggagctcggcggcgagaatacttttgagcaatgcgtgagcgaaatggcgctggcgggc
ttcacaggctgtgaagtaggcaacaagttcccccgcgatgtgaatgtgctgaaaaaagca
ttggaactccgcggattgcagatctgcaaccagtggaacagctacgagctcacgaccaaa
tcgttcaccgagaaccgcgagaatttcaccaaactgctcgatttccttgaagtcatgggc
gcgcgcgtgattggcggcggcgagacgggcaacagctgccagggacaaatgaatgtgccg
gtgttcgaaggcaaagggatgctgagcacccgcgaagaatgggccagcttcacctacggc
ctggacgagctcggcaagattgcccgcgaccgcggcatgaagctcgcgtttcaccatcac
atgggcacgtgcgttcaaaccatggaagaaaccgaccggctgctcaacgaaaccaatccc
gattatgtgttcctcaactacgactgtgggcatttccatttcgcaggcgaggacccggtg
gcggcattgaaaaaatacatcggccgcacggcgcacatccatttgaaagacgtccgcccg
accatccttcaacgcgtgcacgacgaacggctgagctttctcacggctgtcaaaaatggc
gtgttcaccgttccaggtgacccggaagggtgcatcgacttcccctcgctgtttgcgatc
atcagggaaagcgactacgccggctggatcgtcctcgaagccgaacaggaccccgccaaa
gcaaacccgctcgaatacgcgatcatcgcccgcaattttttcagaagtttaacaggcatt
taa

DBGET integrated database retrieval system