KEGG   Dyadobacter fermentans: Dfer_5694Help
Entry
Dfer_5694         CDS       T00970                                 

Definition
xylose isomerase domain-containing protein
Orthology
K03335  
inosose dehydratase [EC:4.2.1.44]
Organism
dfe  Dyadobacter fermentans
Pathway
Inositol phosphate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dfer_5694
Enzymes [BR:dfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     Dfer_5694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6840887..6841789)
Genome map
AA seq 300 aa AA seqDB search
MNFENIQLGVAPINWTNDDMPELGGENTFEQCVSEMALAGFTGCEVGNKFPRDVNVLKKA
LELRGLQICNQWNSYELTTKSFTENRENFTKLLDFLEVMGARVIGGGETGNSCQGQMNVP
VFEGKGMLSTREEWASFTYGLDELGKIARDRGMKLAFHHHMGTCVQTMEETDRLLNETNP
DYVFLNYDCGHFHFAGEDPVAALKKYIGRTAHIHLKDVRPTILQRVHDERLSFLTAVKNG
VFTVPGDPEGCIDFPSLFAIIRESDYAGWIVLEAEQDPAKANPLEYAIIARNFFRSLTGI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgaaaacattcaactgggcgttgctcctattaactggaccaacgacgatatg
ccggagctcggcggcgagaatacttttgagcaatgcgtgagcgaaatggcgctggcgggc
ttcacaggctgtgaagtaggcaacaagttcccccgcgatgtgaatgtgctgaaaaaagca
ttggaactccgcggattgcagatctgcaaccagtggaacagctacgagctcacgaccaaa
tcgttcaccgagaaccgcgagaatttcaccaaactgctcgatttccttgaagtcatgggc
gcgcgcgtgattggcggcggcgagacgggcaacagctgccagggacaaatgaatgtgccg
gtgttcgaaggcaaagggatgctgagcacccgcgaagaatgggccagcttcacctacggc
ctggacgagctcggcaagattgcccgcgaccgcggcatgaagctcgcgtttcaccatcac
atgggcacgtgcgttcaaaccatggaagaaaccgaccggctgctcaacgaaaccaatccc
gattatgtgttcctcaactacgactgtgggcatttccatttcgcaggcgaggacccggtg
gcggcattgaaaaaatacatcggccgcacggcgcacatccatttgaaagacgtccgcccg
accatccttcaacgcgtgcacgacgaacggctgagctttctcacggctgtcaaaaatggc
gtgttcaccgttccaggtgacccggaagggtgcatcgacttcccctcgctgtttgcgatc
atcagggaaagcgactacgccggctggatcgtcctcgaagccgaacaggaccccgccaaa
gcaaacccgctcgaatacgcgatcatcgcccgcaattttttcagaagtttaacaggcatt
taa

DBGET integrated database retrieval system