KEGG   Dyadobacter fermentans: Dfer_5710Help
Entry
Dfer_5710         CDS       T00970                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dfe  Dyadobacter fermentans
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dfe01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6864350..6865099
Genome map
AA seq 249 aa AA seqDB search
MAGYAFFNYKFCTLSIPTMIAVRHFKTFVTLSLLATVLFSCGGEKKEEAAQDAGSTQTAA
KATPAKKKTIVFFGNSLTAGYGLDDPSQAFAGLIQKRIDSLGLNYKVINAGVSGETTSGG
NSRIDWLLKQPLDVFVLELGGNDGLRGIPVSETKKNLQEILDKVKAKYPDAKRVLAGMQI
PPNMGQKYATEFKEVYADLAEKNDVTLIPFLLEGVGGESKLNQSDGIHPTAEGHKILAEN
VWIRIKDIL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtatgcgttttttaactacaaattttgtaccctttcgatacctactatgatc
gcagtgcgtcatttcaaaacatttgtaacattatccctgctcgcgaccgtactgttttcg
tgcggcggcgagaaaaaagaggaggcggctcaggatgccggttccacacaaactgcggca
aaagcaacgcccgcgaaaaagaaaacgatcgttttttttggcaacagcctcaccgccggt
tacggcctcgatgatccgtcacaggcatttgccggactgatccagaaacgcatcgactcg
ctcggcctgaactacaaggtcatcaatgccggagtgagcggtgaaaccacatcgggcggg
aatagccgcatcgactggctgctcaaacaaccgctcgacgttttcgttctcgaactaggc
ggcaacgacggcctgcggggcattccggtttcagaaacgaagaaaaacctgcaagagatc
ctggacaaggtaaaggcgaaatatccggatgcgaaacgcgtgctggcaggaatgcaaatc
ccgccaaacatgggccagaaatacgcaacggaatttaaagaagtatatgctgatcttgcc
gagaagaacgatgtaacgctcatcccattcctgctcgaaggggtgggaggcgagtccaaa
ctgaaccagtccgacggcattcaccccaccgcggaagggcacaagatactggccgaaaat
gtgtggataaggattaaagacatattataa

DBGET integrated database retrieval system