KEGG   Dyadobacter fermentans: Dfer_5753Help
Entry
Dfer_5753         CDS       T00970                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dfe  Dyadobacter fermentans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dfer_5753
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dfer_5753
  Amino acid metabolism
   00310 Lysine degradation
    Dfer_5753
Enzymes [BR:dfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dfer_5753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6911399..6912988
Genome map
AA seq 529 aa AA seqDB search
MAEIEIKVPPVGESITEVTIGNWFKNDGDFVKMDEVICGLDSDKATFELTAEAEGILHIK
AQEGDTLNIGDLIATIEAANGAAPKATAPKAEAAAPAAASAPAAAPAPEPAKAETPAAAP
AATTGQVYEMKVPAVGESISEVTIASWSKKDGDYVTVDEILCELESDKATFELPAEAAGI
LTIVGKEGDTLSIGAVICTIAQTEGAPASASSAPQASAPAAAAPADKGYSEKHASPVAAK
ILAEKGIDPKDVNGSGSGGKIMKDDALKAEKAAPAAAPAAAKPAAAAAPAAAAPAGARAS
RREKMTSLRKTIARRLVAVKNETAMLTTFNEVDMKPIMDLRAKFKDKFKEKHEVGLGFMS
FFVKAVTVALKDFPVVNAYIDGEELVYNDFADISVAVSTPRGLVVPVIRNAENLSFAGVE
KEIVRLAVRARDGKLGLDEMSGGTFTITNGGIFGSMLSTPIINAPQSAILGMHNIVERAV
VIDGQIVVRPIMYVALSYDHRTIDGKDSVSFLVRVKQLLEDPTRLLLDI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaattgaaataaaagtaccgcccgttggcgagtcgattaccgaggttacgata
ggaaactggttcaaaaatgatggcgattttgtgaagatggacgaggtgatctgcggactg
gattcggacaaagcgacatttgaactgaccgcggaagcagaaggtatattgcatattaaa
gcacaggaaggcgatacattgaacatcggtgacctgatcgcgaccatagaagctgccaac
ggcgcggcaccgaaagcaacagctccgaaagcagaagcggctgctcctgcggcggcatcg
gctcctgcggcagctccggcacccgagccggcgaaagctgaaacccccgcggcagcacca
gcggctacgacaggccaggtgtatgaaatgaaagttcccgcggtaggagagtctatcagc
gaagtaacaatcgcttcttggagcaaaaaagatggtgactacgtgactgtggacgaaatc
ctgtgcgaactggaatcggacaaagcgacatttgaactccctgcggaagcagccggtata
ttgacgatcgtcggaaaagaaggcgacacgttgtcgatcggtgcggtgatctgtaccatc
gcgcaaacggagggtgctcctgcatcggcctcgtcagctccgcaagcatcggccccggct
gctgctgcgcctgctgataaaggttacagcgagaaacacgcatcgcctgttgccgcgaaa
atcctggcagaaaaaggaatcgatccgaaagatgtaaacggttccggctcaggaggcaaa
atcatgaaagacgatgcattgaaggctgaaaaagcggctccggctgctgctcctgccgct
gctaaaccggccgctgccgctgctcctgccgccgcagctcctgcgggcgcccgtgcatcc
cgccgcgagaaaatgacgtcgttgcgcaaaaccatcgcccgtcgcctggtagcagtgaaa
aatgaaacggctatgctcaccactttcaatgaagtggatatgaagccgatcatggatttg
cgtgcgaagttcaaagataaattcaaagaaaaacacgaggtaggacttggtttcatgtcg
ttcttcgtgaaggcggtaaccgtggcgttgaaagacttcccggtcgtgaatgcctatatc
gacggagaagagctggtttacaacgattttgcggacatttcagtagccgtatctacaccg
cgcggattggttgtgccggtgatccgcaatgctgagaacctgtcgttcgcgggcgttgag
aaagaaatcgttcgtctggcggttcgtgcgcgtgacggtaaactgggcctcgatgaaatg
tcgggtggtacatttacgatcaccaacggcggtattttcgggtcaatgctttcaactccg
atcattaacgcgccgcaatcggcgatcctcggtatgcataatatcgttgaacgcgcggtg
gtgattgatggccagatcgtcgttcgtccgatcatgtacgtggcactgtcatacgaccac
cggactatcgacggtaaagactcagtgagcttcctggttcgcgtgaaacagctcctcgaa
gacccgacccgtttgttgttggatatttaa

DBGET integrated database retrieval system