KEGG   Dyadobacter fermentans: Dfer_5753Help
Entry
Dfer_5753         CDS       T00970                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00020  Citrate cycle (TCA cycle)
dfe00310  Lysine degradation
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01120  Microbial metabolism in diverse environments
dfe01130  Biosynthesis of antibiotics
dfe01200  Carbon metabolism
Module
dfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dfer_5753
  Amino acid metabolism
   00310 Lysine degradation
    Dfer_5753
Enzymes [BR:dfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dfer_5753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding QRPTase_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ACT96941
UniProt: C6VY40
Position
6911399..6912988
Genome map
AA seq 529 aa AA seqDB search
MAEIEIKVPPVGESITEVTIGNWFKNDGDFVKMDEVICGLDSDKATFELTAEAEGILHIK
AQEGDTLNIGDLIATIEAANGAAPKATAPKAEAAAPAAASAPAAAPAPEPAKAETPAAAP
AATTGQVYEMKVPAVGESISEVTIASWSKKDGDYVTVDEILCELESDKATFELPAEAAGI
LTIVGKEGDTLSIGAVICTIAQTEGAPASASSAPQASAPAAAAPADKGYSEKHASPVAAK
ILAEKGIDPKDVNGSGSGGKIMKDDALKAEKAAPAAAPAAAKPAAAAAPAAAAPAGARAS
RREKMTSLRKTIARRLVAVKNETAMLTTFNEVDMKPIMDLRAKFKDKFKEKHEVGLGFMS
FFVKAVTVALKDFPVVNAYIDGEELVYNDFADISVAVSTPRGLVVPVIRNAENLSFAGVE
KEIVRLAVRARDGKLGLDEMSGGTFTITNGGIFGSMLSTPIINAPQSAILGMHNIVERAV
VIDGQIVVRPIMYVALSYDHRTIDGKDSVSFLVRVKQLLEDPTRLLLDI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaattgaaataaaagtaccgcccgttggcgagtcgattaccgaggttacgata
ggaaactggttcaaaaatgatggcgattttgtgaagatggacgaggtgatctgcggactg
gattcggacaaagcgacatttgaactgaccgcggaagcagaaggtatattgcatattaaa
gcacaggaaggcgatacattgaacatcggtgacctgatcgcgaccatagaagctgccaac
ggcgcggcaccgaaagcaacagctccgaaagcagaagcggctgctcctgcggcggcatcg
gctcctgcggcagctccggcacccgagccggcgaaagctgaaacccccgcggcagcacca
gcggctacgacaggccaggtgtatgaaatgaaagttcccgcggtaggagagtctatcagc
gaagtaacaatcgcttcttggagcaaaaaagatggtgactacgtgactgtggacgaaatc
ctgtgcgaactggaatcggacaaagcgacatttgaactccctgcggaagcagccggtata
ttgacgatcgtcggaaaagaaggcgacacgttgtcgatcggtgcggtgatctgtaccatc
gcgcaaacggagggtgctcctgcatcggcctcgtcagctccgcaagcatcggccccggct
gctgctgcgcctgctgataaaggttacagcgagaaacacgcatcgcctgttgccgcgaaa
atcctggcagaaaaaggaatcgatccgaaagatgtaaacggttccggctcaggaggcaaa
atcatgaaagacgatgcattgaaggctgaaaaagcggctccggctgctgctcctgccgct
gctaaaccggccgctgccgctgctcctgccgccgcagctcctgcgggcgcccgtgcatcc
cgccgcgagaaaatgacgtcgttgcgcaaaaccatcgcccgtcgcctggtagcagtgaaa
aatgaaacggctatgctcaccactttcaatgaagtggatatgaagccgatcatggatttg
cgtgcgaagttcaaagataaattcaaagaaaaacacgaggtaggacttggtttcatgtcg
ttcttcgtgaaggcggtaaccgtggcgttgaaagacttcccggtcgtgaatgcctatatc
gacggagaagagctggtttacaacgattttgcggacatttcagtagccgtatctacaccg
cgcggattggttgtgccggtgatccgcaatgctgagaacctgtcgttcgcgggcgttgag
aaagaaatcgttcgtctggcggttcgtgcgcgtgacggtaaactgggcctcgatgaaatg
tcgggtggtacatttacgatcaccaacggcggtattttcgggtcaatgctttcaactccg
atcattaacgcgccgcaatcggcgatcctcggtatgcataatatcgttgaacgcgcggtg
gtgattgatggccagatcgtcgttcgtccgatcatgtacgtggcactgtcatacgaccac
cggactatcgacggtaaagactcagtgagcttcctggttcgcgtgaaacagctcctcgaa
gacccgacccgtttgttgttggatatttaa

DBGET integrated database retrieval system