KEGG   Deinococcus geothermalis: Dgeo_0139Help
Entry
Dgeo_0139         CDS       T00353                                 

Definition
2-oxoglutarate dehydrogenase E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dge  Deinococcus geothermalis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dgeo_0139
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dgeo_0139
  Amino acid metabolism
   00310 Lysine degradation
    Dgeo_0139
Enzymes [BR:dge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dgeo_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(126791..128068)
Genome map
AA seq 425 aa AA seqDB search
MAEIKVPVFSESVSEGTLLTWHKQPGDAVKRGEVLAEIETDKVVLEVTAQQDGVLTSVTK
HEGDTVLSEEVLGTIGEAGSAPAASTPAPAPDQVSGPVAGEASAGGTAVQADSTGVQSAA
SVATRRDDLSPAVRKIVAEQGLNPAQIPATGPKGNITKADALQAATSSQPAPAAAPVQAP
PPQAAAVQVPQGNRPEQRVPMTRIRQRIAERLKEVQNTAAILTTFNEINMKPAMDLRKKY
QDQFVAKHGVKLGFMSLFVRAATEALKQFPIINASVEGKDIIYHGYYDIGIAVASDRGLV
VPILRDTDQMSLADIEKQIAQFAQKAKTGKLTLEDMSGGTFSITNGGTFGSMMSTPIINA
PQSAILGMHNIIERPVAEQGQFVIRPMMYVALSYDHRIIDGREAVLFLVAIKNALEDPAR
MLLEI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatcaaggtaccagtcttttccgagtcggtgagcgagggcacgctgctgacc
tggcacaagcagcccggcgacgccgtcaagcgcggcgaggttctcgcagagatcgaaacc
gacaaggtggtgctcgaggtcactgcgcagcaggacggcgtcctgacctccgtcaccaag
catgagggggatacggtcctcagcgaggaagtgctgggcaccatcggggaagcgggaagc
gctcccgcggccagcacgccggcccctgccccggaccaggtcagcggccccgttgcgggc
gaggccagcgcgggcggcacggccgttcaggctgacagcaccggtgtgcagtccgctgcg
agcgtggccactcgccgagacgacctctctcctgctgtccgtaagattgtggcggagcag
ggccttaacccggcgcagattcctgcgaccggaccgaaggggaacatcaccaaggcagac
gcgcttcaggcagcgaccagcagccagcctgcgccggctgcagctccggtgcaggctccg
ccccctcaagccgccgccgtgcaggtgccgcagggaaaccggcccgagcagcgcgtccca
atgacccgaatccgccaacgaatcgcggagcggctgaaggaggtccagaacactgccgcg
atcctgaccaccttcaacgagatcaacatgaagcccgcgatggacctgcgcaagaagtat
caggaccagttcgtcgccaagcatggcgtgaagctgggcttcatgagcctcttcgtgcgc
gcggccaccgaagccctcaagcagtttccaatcatcaatgcgagtgttgagggcaaggac
atcatctaccacggctactacgacatcggcatcgcggtggcctccgaccgcggcctggtt
gtgcccatcttgcgtgacaccgaccagatgagcctcgccgacatcgagaagcagatcgcc
caatttgcccagaaggccaagaccggcaagctgacgctggaagacatgagcggcggcacc
ttctccatcaccaacggcggcacctttggctcgatgatgagcaccccgatcatcaacgcg
ccgcaaagcgccattctgggcatgcacaacatcatcgagcgcccagtggccgagcagggc
cagtttgtgattcgcccgatgatgtacgtcgccctcagctacgatcaccgcattattgac
ggccgcgaagccgtgctgttcctggtggcgatcaagaacgctcttgaagacccggcgcgg
atgctgctggagatttaa

DBGET integrated database retrieval system