KEGG   Deinococcus geothermalis: Dgeo_0147Help
Entry
Dgeo_0147         CDS       T00353                                 

Definition
peptidase S13, D-Ala-D-Ala carboxypeptidase C
Orthology
K07259  
D-alanyl-D-alanine carboxypeptidase / D-alanyl-D-alanine-endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
dge  Deinococcus geothermalis
Pathway
Peptidoglycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dge00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
136990..138411
Genome map
AA seq 473 aa AA seqDB search
MVLCRILTPVRRLLPLCLAGLILWSGSRAQAPEAGERVTLRRDPGLSAGVQRALTRLPEG
VRVGLLVRDLTTGELLEAREADLPLIPASNMKLVTAASVLLDRGGVGGWWSTELTLPAAE
VGRASVSHLTLRGDADPTLTAVDGPNSLQALARQVHARGVREVGAVWVDESRLDAATWRG
LALGVPMTAVRLAEWHDDPPASAAEARARVGAALIRELRRAGVRVRSDAVIPAPPFRPYT
PPPRRDERGHLLPPDPFIPPEHRPEEGVASVRSGSPFGVLAATLRPSDNLRAEELLATLA
VRPSGNGTLPGALARERGVLRRLDVDLTGIRLVDGSGLSRENRLTVRALVQLLKVMYDLP
YPTGTPQAELPSRTYRDRRNAYAEALPQAGTGENVPAHDGRGGTLALRLMGSGLDVRAKT
GTLPGVSSLAGYVTGRSGHPLAFALLMNGPEDSPILTLRAIQDEVVRAVAAAH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttggtcctctgccgtatcctgactcctgtgcgccgtctccttcccctgtgccttgccggc
ctgatcctctggtcgggctcgcgggcgcaggcgccggaggcaggcgagcgggtgacgctg
cggcgtgatcccgggttgagcgccggggtgcagcgggcgctgacgcggctgccggaggga
gtgcgggtcgggctgctcgtccgcgacctgacaaccggggaactgctggaggcgcgcgag
gccgacctcccgctgattccggccagcaacatgaagctggtcacggcggcctcggtgctt
ttggaccgcggcggcgtgggcggctggtggagtaccgaactgacgctgcccgccgccgag
gtgggccgagcaagcgtgtcgcacctgaccctgcgcggagacgccgatcccaccctgacc
gctgtggacgggccgaacagcctgcaggccctcgcccggcaggtccacgcccggggggtg
cgcgaggtgggtgccgtgtgggttgacgagagcaggctggatgcggcgacctggcgcggg
ttggcgctgggcgtgcccatgacggctgtgcgtctggccgagtggcacgacgacccgcct
gcctccgccgccgaggcccgtgcccgggtgggggccgcgctgattcgcgagctgcgccgc
gccggcgtccgcgttcgctccgacgctgtcatcccggcgcccccctttcgaccctacacg
ccgcctccccgccgcgacgagcggggacatctcctcccccctgacccctttattccaccc
gagcaccgccccgaggagggcgtggcgtccgtgcgcagcggttctcccttcggggtgctg
gccgccacgctgcgccccagtgacaacctccgggcggaagaactgctggccaccctcgct
gttcggccgagtggaaacggcacccttcctggtgccctggcgcgtgagcggggggtgttg
cggcgtctggacgtcgacctcaccggcattcgcctggtggacggcagcgggctgagccgg
gaaaaccgcctgacggtccgcgcgctggtgcagctcctgaaggtgatgtacgacctgccc
tatcctaccggaactcctcaggccgaactgccgagccggacctaccgcgatcgccgcaac
gcctacgcggaggcgctcccgcaggccgggacgggcgagaatgtgcctgcgcacgacggg
cgtggcggcacactggcattgcgactgatgggcagcggtctggacgtgcgcgccaagacc
ggcacgctccccggcgtgagcagcctcgccgggtacgtgacggggaggagcggccatccg
ttggccttcgccctgctgatgaatggaccggaggacagcccgattctcacgctgcgtgcc
atccaggacgaggtggtgcgggcggtggcagcggcccactag

DBGET integrated database retrieval system