KEGG   Deinococcus geothermalis: Dgeo_0147Help
Entry
Dgeo_0147         CDS       T00353                                 

Definition
peptidase S13, D-Ala-D-Ala carboxypeptidase C
Orthology
K07259  
D-alanyl-D-alanine carboxypeptidase / D-alanyl-D-alanine-endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
dge  Deinococcus geothermalis
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dgeo_0147
Enzymes [BR:dge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Dgeo_0147
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Dgeo_0147
Peptidases [BR:dge01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Dgeo_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
136990..138411
Genome map
AA seq 473 aa AA seqDB search
MVLCRILTPVRRLLPLCLAGLILWSGSRAQAPEAGERVTLRRDPGLSAGVQRALTRLPEG
VRVGLLVRDLTTGELLEAREADLPLIPASNMKLVTAASVLLDRGGVGGWWSTELTLPAAE
VGRASVSHLTLRGDADPTLTAVDGPNSLQALARQVHARGVREVGAVWVDESRLDAATWRG
LALGVPMTAVRLAEWHDDPPASAAEARARVGAALIRELRRAGVRVRSDAVIPAPPFRPYT
PPPRRDERGHLLPPDPFIPPEHRPEEGVASVRSGSPFGVLAATLRPSDNLRAEELLATLA
VRPSGNGTLPGALARERGVLRRLDVDLTGIRLVDGSGLSRENRLTVRALVQLLKVMYDLP
YPTGTPQAELPSRTYRDRRNAYAEALPQAGTGENVPAHDGRGGTLALRLMGSGLDVRAKT
GTLPGVSSLAGYVTGRSGHPLAFALLMNGPEDSPILTLRAIQDEVVRAVAAAH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttggtcctctgccgtatcctgactcctgtgcgccgtctccttcccctgtgccttgccggc
ctgatcctctggtcgggctcgcgggcgcaggcgccggaggcaggcgagcgggtgacgctg
cggcgtgatcccgggttgagcgccggggtgcagcgggcgctgacgcggctgccggaggga
gtgcgggtcgggctgctcgtccgcgacctgacaaccggggaactgctggaggcgcgcgag
gccgacctcccgctgattccggccagcaacatgaagctggtcacggcggcctcggtgctt
ttggaccgcggcggcgtgggcggctggtggagtaccgaactgacgctgcccgccgccgag
gtgggccgagcaagcgtgtcgcacctgaccctgcgcggagacgccgatcccaccctgacc
gctgtggacgggccgaacagcctgcaggccctcgcccggcaggtccacgcccggggggtg
cgcgaggtgggtgccgtgtgggttgacgagagcaggctggatgcggcgacctggcgcggg
ttggcgctgggcgtgcccatgacggctgtgcgtctggccgagtggcacgacgacccgcct
gcctccgccgccgaggcccgtgcccgggtgggggccgcgctgattcgcgagctgcgccgc
gccggcgtccgcgttcgctccgacgctgtcatcccggcgcccccctttcgaccctacacg
ccgcctccccgccgcgacgagcggggacatctcctcccccctgacccctttattccaccc
gagcaccgccccgaggagggcgtggcgtccgtgcgcagcggttctcccttcggggtgctg
gccgccacgctgcgccccagtgacaacctccgggcggaagaactgctggccaccctcgct
gttcggccgagtggaaacggcacccttcctggtgccctggcgcgtgagcggggggtgttg
cggcgtctggacgtcgacctcaccggcattcgcctggtggacggcagcgggctgagccgg
gaaaaccgcctgacggtccgcgcgctggtgcagctcctgaaggtgatgtacgacctgccc
tatcctaccggaactcctcaggccgaactgccgagccggacctaccgcgatcgccgcaac
gcctacgcggaggcgctcccgcaggccgggacgggcgagaatgtgcctgcgcacgacggg
cgtggcggcacactggcattgcgactgatgggcagcggtctggacgtgcgcgccaagacc
ggcacgctccccggcgtgagcagcctcgccgggtacgtgacggggaggagcggccatccg
ttggccttcgccctgctgatgaatggaccggaggacagcccgattctcacgctgcgtgcc
atccaggacgaggtggtgcgggcggtggcagcggcccactag

DBGET integrated database retrieval system