KEGG   Deinococcus geothermalis: Dgeo_0206Help
Entry
Dgeo_0206         CDS       T00353                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dge  Deinococcus geothermalis
Pathway
dge00790  Folate biosynthesis
dge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dgeo_0206
Enzymes [BR:dge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dgeo_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABF44509
JGI: Dgeo0206
UniProt: Q1J1X5
Position
192328..192936
Genome map
AA seq 202 aa AA seqDB search
MTTSTISAADERQEVPGLSALTYDWLTAIGENPEREGLLKTPHRVAKAWRFLTAGYHQTL
ADAAGDAVFEAEGSEMVIVKDIEFYSMCEHHMLPFYGRAHIAYIPDGKILGLSKFARIVD
LYARRLQVQERITTQIADAVEELLSPRGVAVLMEGVHLCMAMRGVQKQNSSTTTSAMRGV
FKEDARTRAEFMSAVQNTLRSR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgaccacctccaccatcagcgcggccgacgaacggcaggaagtgccgggtctgagtgcc
ctgacctacgactggctcacggcgatcggcgagaaccccgagcgcgagggccttctcaag
acgccgcaccgcgtggccaaagcctggcgcttcctgaccgctgggtatcaccagaccctg
gccgacgctgctggcgacgccgtctttgaggccgagggcagcgagatggtgatcgtcaag
gacatcgagttctattcgatgtgcgagcaccacatgctccccttctatggccgggcgcac
atcgcctacatccccgacggcaagatcctggggctgagcaagttcgcgcggatcgtggac
ctgtacgctcggcggttgcaggtgcaggaacgcatcacgacccagattgccgatgccgtg
gaggagctgctttccccgaggggggtggcggtgctgatggagggggtgcacctgtgcatg
gcgatgcgcggcgtgcagaagcagaattcgagcacgacgacgagtgcgatgcgcggggtg
ttcaaggaggatgcccgcacccgtgccgagttcatgagcgcggtgcagaacaccctccgc
agccgctga

DBGET integrated database retrieval system