KEGG   Deinococcus geothermalis: Dgeo_0242Help
Entry
Dgeo_0242         CDS       T00353                                 

Definition
(GenBank) ROK domain protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dge  Deinococcus geothermalis
Pathway
dge00010  Glycolysis / Gluconeogenesis
dge00052  Galactose metabolism
dge00500  Starch and sucrose metabolism
dge00520  Amino sugar and nucleotide sugar metabolism
dge00521  Streptomycin biosynthesis
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
Module
dge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_0242
   00052 Galactose metabolism
    Dgeo_0242
   00500 Starch and sucrose metabolism
    Dgeo_0242
   00520 Amino sugar and nucleotide sugar metabolism
    Dgeo_0242
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dgeo_0242
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dgeo_0242
Enzymes [BR:dge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dgeo_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FtsA Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABF44545
JGI: Dgeo0242
UniProt: Q1J1T9
Position
complement(229150..230112)
Genome map
AA seq 320 aa AA seqDB search
MGRGNWKRSREVEEGGRRVTELAQQVSIGIDVGGTKIASGILRGGELQERHVQPTPSSGW
EAVLNAIAARVRELQARHPDVVQVGVGVPGPLNADRTRVKFAPNIYGFTDVPLVDGLEER
LGVRVVLENDAKAAALAEAHLGAARGTGSSVYVTVSTGIGAGIVLNGRIWRGRHGIAGEL
GHVTVMPGGPVSGAGLDGALEAVASGTAIARDASYALNRGVSTAEAFALAAQGQPAARRI
VAQALKHIGVALADLQKLLDPEVIVIGGGVASVGELFFQGVRAAAEEYAAPFAPVTILPA
QLGTDAGVIGAALAAQQEAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcgggaattggaagcgctcccgcgaagtagaagagggaggcagaagagtgacg
gaactagcgcagcaggtcagcatcggcatcgacgtgggcggcaccaagatcgccagcggg
attctgcgcggcggcgagttgcaagagcgccacgtgcagcccacccccagcagtggctgg
gaagcggtgctgaacgccatcgcggcacgggtgcgcgagttgcaggcccgacatccggat
gtggtgcaggtcggcgtgggcgtgccggggccactcaacgctgaccgcacccgcgtgaag
tttgcgcccaacatctatggctttacagatgtgccgctggtagacggcctggaagagcgc
ttgggcgtgcgggtggtgctggaaaacgacgccaaggccgctgccctcgccgaagcgcac
ctgggggcggcacgtggcacaggcagcagcgtgtatgtgaccgtcagcacggggatcggc
gcggggatcgtgctgaatgggcgcatctggcgcggtcggcacgggatcgccggggaactc
gggcacgtgaccgtgatgccgggcgggccggtcagcggggcgggcctcgacggggcgctc
gaagcggtggcgagcggcaccgccatcgcccgcgatgcgagctacgccctgaaccgtggg
gtgtccaccgccgaggcctttgccttggctgcgcagggccaacccgccgcccgccgcatc
gtggcgcaggccctcaagcacatcggggttgccctggccgacctccaaaagctcctcgat
cccgaagtaatcgtgatcggaggtggcgtggcgagcgtcggggagctgtttttccagggc
gtccgcgctgccgccgaggaatatgccgctcccttcgcgccggtcacgattctgcccgca
cagctcggcacggacgccggggtaattggagcggcccttgccgcgcagcaggaggccgca
tga

DBGET integrated database retrieval system