KEGG   Deinococcus geothermalis: Dgeo_0242Help
Entry
Dgeo_0242         CDS       T00353                                 

Definition
ROK domain-containing protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dge  Deinococcus geothermalis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dgeo_0242
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_0242
   00052 Galactose metabolism
    Dgeo_0242
   00500 Starch and sucrose metabolism
    Dgeo_0242
   00520 Amino sugar and nucleotide sugar metabolism
    Dgeo_0242
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dgeo_0242
   00524 Butirosin and neomycin biosynthesis
    Dgeo_0242
Enzymes [BR:dge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dgeo_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(229150..230112)
Genome map
AA seq 320 aa AA seqDB search
MGRGNWKRSREVEEGGRRVTELAQQVSIGIDVGGTKIASGILRGGELQERHVQPTPSSGW
EAVLNAIAARVRELQARHPDVVQVGVGVPGPLNADRTRVKFAPNIYGFTDVPLVDGLEER
LGVRVVLENDAKAAALAEAHLGAARGTGSSVYVTVSTGIGAGIVLNGRIWRGRHGIAGEL
GHVTVMPGGPVSGAGLDGALEAVASGTAIARDASYALNRGVSTAEAFALAAQGQPAARRI
VAQALKHIGVALADLQKLLDPEVIVIGGGVASVGELFFQGVRAAAEEYAAPFAPVTILPA
QLGTDAGVIGAALAAQQEAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcgggaattggaagcgctcccgcgaagtagaagagggaggcagaagagtgacg
gaactagcgcagcaggtcagcatcggcatcgacgtgggcggcaccaagatcgccagcggg
attctgcgcggcggcgagttgcaagagcgccacgtgcagcccacccccagcagtggctgg
gaagcggtgctgaacgccatcgcggcacgggtgcgcgagttgcaggcccgacatccggat
gtggtgcaggtcggcgtgggcgtgccggggccactcaacgctgaccgcacccgcgtgaag
tttgcgcccaacatctatggctttacagatgtgccgctggtagacggcctggaagagcgc
ttgggcgtgcgggtggtgctggaaaacgacgccaaggccgctgccctcgccgaagcgcac
ctgggggcggcacgtggcacaggcagcagcgtgtatgtgaccgtcagcacggggatcggc
gcggggatcgtgctgaatgggcgcatctggcgcggtcggcacgggatcgccggggaactc
gggcacgtgaccgtgatgccgggcgggccggtcagcggggcgggcctcgacggggcgctc
gaagcggtggcgagcggcaccgccatcgcccgcgatgcgagctacgccctgaaccgtggg
gtgtccaccgccgaggcctttgccttggctgcgcagggccaacccgccgcccgccgcatc
gtggcgcaggccctcaagcacatcggggttgccctggccgacctccaaaagctcctcgat
cccgaagtaatcgtgatcggaggtggcgtggcgagcgtcggggagctgtttttccagggc
gtccgcgctgccgccgaggaatatgccgctcccttcgcgccggtcacgattctgcccgca
cagctcggcacggacgccggggtaattggagcggcccttgccgcgcagcaggaggccgca
tga

DBGET integrated database retrieval system