KEGG   Deinococcus geothermalis: Dgeo_0396Help
Entry
Dgeo_0396         CDS       T00353                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dge  Deinococcus geothermalis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dge00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
403148..404056
Genome map
AA seq 302 aa AA seqDB search
MSRVSDVWPRRPHRLSFGFPVPGGERTAEGWQIEWTGCAVMGVLNVTPDSFSDGGQHATL
EAALAQARAMRDAGALIIDVGGESTRPGAEPVPAEQELDRVRPVLRALAGEGILLSVDTL
KAEVAAAALAAGAHLINDVNGLRDPAMLQVCAAAGAPACIMHMQGEPRTMQVAPHYDDVV
AEVHAFLRTQAQTALAAGVPSVLLDPGLGFGKTLAHNLTLLRALPELTAGPFPVLVGASR
KRLIDFLAEVPRPADRDPGSLALHLYAARQGAALVRAHAAGAHVQALRVEAALEDPSLAP
AR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgggtgtctgacgtctggccgcggcgcccgcatcggctcagcttcggcttcccg
gtgccagggggagagcgcacggcagagggctggcagatcgagtggaccggctgcgcggtg
atgggcgtgctcaacgtcaccccggatagtttcagtgatggcggccaacatgccacgctg
gaggctgccctggcccaagcgcgggccatgcgcgacgcgggcgcgctcattattgatgtg
ggcggcgagagcacccgccccggtgccgagccggtgcccgccgagcaggaactcgaccgg
gtgcggccggtgctgcgggcgcttgccggggaaggcatcctcctcagtgtggatacgctg
aaagccgaggtggctgcagcggccttggcggcgggcgcccatctgatcaacgacgtgaac
ggcctgcgcgatcccgcgatgctgcaggtttgtgcggcggcgggggcccctgcctgcatc
atgcatatgcagggcgagccgcgaaccatgcaagtggccccccactatgacgatgtggtg
gctgaggtccatgctttcctcaggacccaggcccagacggctttggcagcgggcgtaccg
tccgtgttgctggatcctggcctcggctttggaaaaacccttgcccacaacctgaccctg
ctgcgtgccctcccggagctgacggccggaccgttcccggtgctggttggagcgagccgc
aagcgcctcatcgacttcttggccgaggtgccgcgcccagcagatcgtgatccggggagt
ctcgccctgcatctgtatgctgcgcggcagggagccgccctggtgcgtgcccatgcagcg
ggtgctcatgtgcaggcgctgcgggtcgaggccgcgctggaggatccgtccctggcgccc
gcccgctag

DBGET integrated database retrieval system