KEGG   Deinococcus geothermalis: Dgeo_0398Help
Entry
Dgeo_0398         CDS       T00353                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dge  Deinococcus geothermalis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dgeo_0398
Enzymes [BR:dge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Dgeo_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
404438..404929
Genome map
AA seq 163 aa AA seqDB search
MSARAFIALGANLGEPLVTLRRAREELSTLGTLKGVSGLYRTVPVGGPPGQPDYFNAAVS
IWTALGPADLLAALHRIEARAGRVRRERWEARVLDLDLILYGDCVQDAPDLTLPHPRAWE
RAFVLAPLADLDPELSHPLTGERVRAALERVGLSGVTRVASVW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcgggccttcatcgcgttgggggcgaacttgggcgaaccgctcgtcacgctg
cgccgcgcccgtgaagaactgagcacactcggcaccctcaagggggtcagcgggctgtac
cgcacggtgcccgtgggcggccctcccggacagcccgattacttcaatgctgccgtcagc
atctggacggccctcgggcctgccgacctgctggccgccctgcaccgcatcgaggcgcgg
gcgggccgcgtccgccgtgagcgctgggaggcgcgggtcctcgacctcgacctgattctg
tatggcgattgtgtgcaggacgcgccggatctgaccctcccgcatccgcgtgcctgggag
cgggcctttgtgttggccccgctcgcagacctcgatccggagttgagccatcccctgacc
ggcgagcgtgtgcgcgcggcgctggagcgggtcggactgagcggggtcacgcgcgtcgcc
tccgtctggtga

DBGET integrated database retrieval system