KEGG   Deinococcus geothermalis: Dgeo_0412Help
Entry
Dgeo_0412         CDS       T00353                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dge  Deinococcus geothermalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dgeo_0412
Enzymes [BR:dge01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Dgeo_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(420516..421976)
Genome map
AA seq 486 aa AA seqDB search
MTAALGQVRARTLGELLQTPDYAGRTPFDGKVRTVQDEVRDNLTRKLRQGEALFPGVIGY
DETVIPQLVNALLARQNFILLGLRGQAKSRILRAITGLLDEYVPVIDGVDMPDDPLNPIG
AEGRHLLEAHGLELPIRWLPREDRYVEKLATPDVTVADLIGDVDPIKAARLGTSLGDTRS
MHFGLLPRANRGIFAVNELADLAPKVQVALFNILQEGDVQIKGYPIRLELDVMLVFSANP
EDYTARGKIVTPLKDRIGSEIRTHYPTDVRLGMNITAQEAVKAPDVVVPEFIAELIEEIA
FQAREDARVDKMSGVSQRLPISLMEVAAANAERRSLVSGDAPVVRVSDVYAGLPAITGKL
ELEYEGELKGADNVAREVIRKAAGAVYARRYASFDTRELEKWFENGNVFRFPQSGDAGAA
LKAIRQVPGLTDLAAQVAGSSDDATRVSAAEFVLEGLYGRKKLSRAEETYAAPEPDVRQQ
RGGRWN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgcattgggacaggtgagggccaggacgctcggagaactgctgcagacgccg
gattacgcgggccgcacgccctttgacggcaaggtgcggaccgtgcaggacgaggtgcgg
gacaacctcacgcgcaagctgcgccagggcgaggcgctgttccccggggtgatcggctac
gacgaaacagtgatcccgcaactcgtgaacgcgctgttggcccgccagaactttatcctg
ctggggctgcgcggacaggccaaaagccgcatcctgcgcgcgatcactggcctgcttgac
gagtacgtgcccgtgatcgacggcgtggacatgcccgacgaccccctcaaccccatcggc
gctgagggccggcacctgctggaagcccacggactggagctgccgatccgctggctgccc
cgcgaggaccgctatgtggagaagctcgccacgccggacgtgacggtagcggacctgatc
ggggacgtggaccccatcaaggcggcccgcctgggcacctcactgggcgacacccgctcg
atgcacttcgggctgctgccacgtgccaaccgcggcattttcgcggtgaacgagctcgcc
gacctcgcgcccaaggtgcaggtggccctctttaacatcctgcaggagggggacgtccag
atcaagggctaccccatccggctggaactcgacgtgatgctggtcttttcggccaatccc
gaggactacaccgcgcgcggcaagatcgtcacgcccctcaaggaccgcatcggctcagaa
atccgcacccactacccgaccgacgtgcgactcggcatgaacatcactgcgcaggaggcc
gtcaaggccccggacgtggtggtgcccgagttcatcgcggagctgatcgaggagatcgcc
ttccaggcccgcgaggacgcccgcgtggacaagatgagcggcgtgtcgcagcgcctcccg
atcagcctgatggaggtcgccgccgcgaatgctgaacgccgcagcctggtgtccggggac
gctccagtggtgcgcgtcagtgacgtgtacgctggccttccggcgatcaccggcaagctc
gaactggagtacgagggcgaactcaagggcgcagacaacgtcgcccgcgaggtgattcgc
aaggccgccggggccgtgtacgctcgccgttacgccagcttcgacacccgcgagctggag
aagtggttcgagaacggcaacgtcttccgtttcccgcagtcgggcgatgcgggggccgcc
ctcaaggccatccgccaggtgcccggcctaaccgacctcgccgcccaggtggcaggcagc
agcgacgacgccacgcgggtcagcgccgccgagttcgtgttggaagggctatacggacgc
aagaagctcagccgcgccgaagaaacctacgcggcgcccgagccggacgtgcgccagcag
cgcgggggacgttggaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system