KEGG   Deinococcus geothermalis: Dgeo_0575Help
Entry
Dgeo_0575         CDS       T00353                                 

Definition
(GenBank) ROK domain protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
dge  Deinococcus geothermalis
Pathway
dge00010  Glycolysis / Gluconeogenesis
dge00520  Amino sugar and nucleotide sugar metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
Module
dge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_0575
   00520 Amino sugar and nucleotide sugar metabolism
    Dgeo_0575
Enzymes [BR:dge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Dgeo_0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABF44877
JGI: Dgeo0575
UniProt: Q1J0V7
Position
614053..614865
Genome map
AA seq 270 aa AA seqDB search
MLAASDSSQHGGKAVTLSPMSVILGIDIGGSGIKGAPVDTATGKLVAERHRIPTPEGAHP
DAVKDVVVELVRHFGHAGPVGITFPGIVQHGHTLSAANVDKAWIGLDADTLFTEATGRDV
TVINDADAAGLAEARFGAGAGVPGEVLLLTFGTGIGSALIYNGVLVPNTEFGHLYLKGDK
HAETWASDRAREQGDLNWKQWAKRVSRYLQYLEGLFSPDLFIIGGGVSKKADKWQPHVAT
TRTRLVPAALQNEAGIVGAAMVAAQRSQGD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgctggcagccagtgacagcagccagcatggcgggaaggctgttacgctatctcccatg
agcgtgatcctcgggattgacataggtgggagcggcatcaagggggcccctgtggacacg
gcaaccgggaagctggtggccgagcgccaccgcatccccacgcccgagggcgcgcaccca
gacgcggtgaaggacgtggtggttgagctggtgcggcattttgggcatgcggggccagtc
ggcatcactttccctggcatcgtgcagcacggccataccctgagcgcagccaatgtggat
aaagcctggattggcctggacgccgacacgctttttactgaggcgaccggtcgcgacgtg
accgtgatcaacgacgcagatgccgcggggctagcggaggcgaggttcggggccggggca
ggtgtgccgggcgaggtgttgctgttgacctttgggacaggcatcggcagcgcgctgatc
tataacggcgtgctggtgcccaacaccgagtttgggcatctgtatctcaagggcgacaag
cacgccgagacatgggcgtccgaccgggcccgtgagcagggcgacctgaactggaagcag
tgggccaaacgggtcagccggtacctccagtatctggaaggtctcttcagtcccgatctc
tttatcatcggtgggggcgtgagcaagaaggccgacaagtggcagccgcacgtcgcaaca
acacgtacccgcctggtgcccgctgccctccagaacgaggccggaatcgtgggggccgcg
atggtggcggcgcagcggtcacagggggactaa

DBGET integrated database retrieval system