KEGG   Deinococcus geothermalis: Dgeo_0725Help
Entry
Dgeo_0725         CDS       T00353                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
dge  Deinococcus geothermalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dgeo_0725
Enzymes [BR:dge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Dgeo_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
784017..786413
Genome map
AA seq 798 aa AA seqDB search
MSDASAQNPPEQLLATPGSPELISPAQGLAPGAPGLPPTWASSDKDFVTTALGGASRLWA
TGGHGMLNEVYWPSTGQPQIRDLTFYLVGAAGWVDLRRVRRYQLSTPKPYLPLPTLLHQG
DDYQLMLEVLPDPHRDVLLIRYALSGPYRLAIVLAPHLTSTGHDNAAWVEGQHLLAVSGN
RALALLSSSRMEHLSAGYVGVSDGWQDLHQHGRLTWSYERAENGNVALSAELQDASGLLA
LGFAENVTGAQGLARASLAEGDEPARRAFLYAWEAWGSALKLGGPSPELEAEALLSATVL
KVHEDRTYPGALVASLSIPWGDSTDTLGGYHLVWPRDATLAAFALLACNQREDARRVLAW
FIANQQPDGHWLQNYYPDGQDFWHGVQLDETAFPVLLAAKLREEGEPELEGTRDMVRRAL
AFVARTGPTSDQDRWEENQGVNPFTLAVAIAALVAGSGWLEEDERHYALSLADDWNERLE
SLCYVTGTPLCRELGVEGYYVRLAPPDRDGTLTGQVTLQNRQGKTVEAAALVSLDFSYLP
RLGLRSALDPRIRDTVKVVDQLLAQKTPTGIFYHRYNGDGYGEHEDGAPYDGSGMGRLWP
LLSGERGHLALQAGEDATVYLNSLLRCSSPGGLLPEQVWDGPPLPERGLFPGRPSGSAMP
LLWAHAEFLKLLHTAQTGRPAELLREVEERYRQPLPAQARHWRPAAPVPELEPGLLLLIE
DDKPFLLHYGFDGWQNPQDRPALRLPFGLWGVTFSPGELREHHTLDFTRKLAVGWEGQDH
HIRLHEGAPKASLTAQNG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcttccgctcagaaccccccagaacagctcctggcaaccccaggttccccg
gaactgatttctcccgcccagggcctggcccccggtgcccccggcctgcccccaacctgg
gcgagcagcgacaaggacttcgtgacgacggccctggggggcgcgtcccgactgtgggcg
accggtggccacggaatgctgaacgaggtgtattggccctccaccgggcagccacagatt
cgtgacctgaccttttatctggtgggggcggccggctgggtggacctgaggcgggtgagg
cgctaccagctgtccacgcccaagccgtatctgccccttcctaccctgctgcaccagggg
gacgactaccagctcatgctggaggtgctgcccgatccacaccgcgacgtgctgctgatc
cgctacgccctgagcggtccctatcgcctggcgatcgtgctggcgccccacctcacctcc
accggacatgacaacgccgcctgggtcgagggtcagcacctgctggcggtgtccgggaac
cgcgcgctcgcgctgctgtcgagcagccggatggaacacctgagcgccgggtacgtggga
gtttcggacggctggcaggacttgcaccagcatgggcgcctcacctggagctacgagcgg
gcggaaaacggcaacgtggccctcagtgccgagctgcaggatgcctccgggcttctggca
ctgggttttgcggaaaacgtgaccggcgcgcagggcctggcccgcgccagcctcgcggaa
ggggacgagcctgcccgccgcgcctttttgtacgcctgggaagcctggggcagcgccctc
aagctcggcggtcccagccctgagttggaggccgaggctcttctcagcgcgacggtcctc
aaggtgcacgaggaccgcacctatcccggcgcgctggtcgccagcctcagcattccctgg
ggagacagcaccgacacgctgggcggctaccaccttgtctggccgcgcgacgcgacgctg
gcggcctttgctctgctggcctgcaatcagcgtgaggacgcgcgccgggtgctggcgtgg
ttcattgccaaccagcagcccgacggccactggctccagaactactatccagacggtcag
gacttctggcacggcgtgcagctcgacgagacggcctttccggtgctgctggccgccaag
ctgcgcgaggagggcgagccggagctggagggcactcgcgacatggtgcgccgcgcgctt
gcctttgtggcccgcaccggtcccaccagtgaccaggaccgctgggaggagaaccagggg
gtgaacccctttacgttggcggtcgcgattgccgcgctggtggcggggtcgggctggttg
gaggaggacgagcgccactatgccctcagcctggcggatgactggaacgagcggctggaa
agcctctgctacgtgaccggcacgccgctgtgccgtgagctgggggtggagggctactac
gtgcggctggcgccccctgaccgcgacggcaccctcaccggccaggtgacgctccaaaac
cgccaaggcaaaacggtagaggcagcggcgttggtcagtctggatttttcttatctgccg
cgactgggcctgcgttcggcgctcgatccacgcattcgcgacaccgtgaaggtggtggat
cagctgctggcccaaaagacgccgaccggcatcttctaccaccgctacaacggcgatggc
tacggcgaacacgaggacggggcgccctacgacggctccggaatggggcggttgtggccg
ctgctgagcggcgagcgtggccacctggcgcttcaggcgggcgaggacgccaccgtctac
ctcaacagcctgctgcgctgctctagccccggcggcctgctgcccgagcaggtctgggac
gggccacccctgcccgaacgcggcctctttcccgggcggcccagcggcagcgcgatgccg
ctgctgtgggcgcacgctgaatttctgaagctgctgcacaccgcgcagacgggccgcccc
gccgaactgttgcgcgaggtggaggaacgctaccgccagcctcttcctgcccaggctcgc
cactggcgccccgccgcaccggtgcccgaactcgaacccggcctgctgctgctgatcgag
gatgacaagcctttcctgctgcactacggctttgatggctggcaaaacccccaggaccgc
ccagccctgcgcctcccctttggcctgtggggtgtcaccttcagtccgggcgaactgcgc
gagcaccacaccctcgacttcacgcgcaagctggcggtgggttgggaggggcaggaccat
cacatccggctccatgagggcgcgcccaaggcgtccctgaccgcgcagaacgggtga

DBGET integrated database retrieval system