KEGG   Deinococcus geothermalis: Dgeo_0726Help
Entry
Dgeo_0726         CDS       T00353                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dge  Deinococcus geothermalis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dge03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
786449..787045
Genome map
AA seq 198 aa AA seqDB search
MIAYLSGAVREVREASAVIVAGGVGYEVFCPASTLGRLVPGQPAELNIRHVVREDAQLLF
GFLDTDSLRLFDLLIGVSGVGPKLALSLLSALPVTAVAQGLLSGDVKLLSSVSGVGKKTA
ERLVLELQNKVPEHLAAGAPVSAGKAALTSTAGRDAIEALLALGFREPQVRSVVAELLAA
DPEQSADALIRKGLGKLR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcctacctgagtggcgcggtgcgcgaggtgcgcgaggcgagcgctgtcattgtc
gccgggggtgtgggctacgaggtcttctgccccgcttccaccctggggcgactggtccct
ggccagcccgccgagctgaatatccgccatgtcgtgcgcgaggacgcccagctgcttttc
ggctttctggacaccgacagcctgcgcctcttcgacctgctgatcggtgtgagcggcgtt
ggtcctaagttggccctcagcctgctttcggccctgccggttacggccgtcgcccagggc
ctcttgagcggcgatgtgaagctgctctccagcgtttccggcgtgggcaagaagaccgcc
gagcgtctggtgctggaactgcagaacaaggtgccggagcacctggcggcgggcgcgccg
gtcagcgctgggaaagctgccctcaccagcaccgctggacgcgacgcgatcgaggcgctg
ctggccctcggcttccgcgagccgcaggtgcgcagcgtggtggccgagctgctcgccgcc
gatccggagcagagtgcggatgccctgattcgcaaggggttagggaaactgcgttga

DBGET integrated database retrieval system