KEGG   Deinococcus geothermalis: Dgeo_0826Help
Entry
Dgeo_0826         CDS       T00353                                 

Definition
helicase RecD/TraA
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dge  Deinococcus geothermalis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dgeo_0826
Enzymes [BR:dge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dgeo_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
884570..886750
Genome map
AA seq 726 aa AA seqDB search
MREPPGVFPSRGVRARKGAILAGMSAGLPTEPFRVTGGVNKVRFRAESGFTVMSARLRNA
EGEDPDATVIGVMPPLEVGDSFSAEVLMEEHREYGHQYRVLNMVLEAQPADLTEAGVAAY
LEARVGGVGKVLAGRIARTFGPATFDVLEQEPEKLLQVPGVTASTLHKMVSSWSQQGLER
RLLAGLQGLGLSISQAQRAVKHFGEAALERLQADLFALTEVEGIGFLTADRLWQAQGGAQ
DDPRRLTAAAVYALQQAGQQGGHAFLPRARAERGVLHYTRVSPEQARLAVETATELGRLA
DDPTPAGESRIYLPHVLRTEKKLAGLIRTLLATPPAGAEWAVPVGAAQGLSEEQARVLQL
LEDHRLVVLTGGPGTGKSTATRAVADLAERLGLEVGLCAPTGKAARRLGEVTGRPASTIH
RLLGYGPAGFRHNHLEPAPYDLLIVDEVSMTGDALMLSLLAAVAPGARVLLVGDTDQLPP
VDSGLPLLAIAQTAPTVRLSTVYRQAAENPIIRAAHGLLHGQAPSWGDPRLDLTETEPDV
GARRVALMVRDLGGPGRVQVLTPMRKGPLGVETLNRHLQALFNPGEGGTRIADGEARPGD
VVVQTKNDYQNEVFNGTVGTVLKAEGGRLTVDFDGNIVELAGAELFNLQLGYALTVHRAQ
GSEWPTVLGVLHEVHMPMLSRNLAYTALTRARERFLAVGSASAWEKAAGRQREERNTALL
ERIRRR
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgaaccccccggggtttttccgtcacggggggttcgcgcgagaaagggcgctatc
ctggcgggcatgagcgctggcctcccgaccgaacctttccgcgtgaccggaggtgtgaat
aaggtccgcttccgtgcggagagcggctttacggtcatgagtgcccggctgcggaatgct
gaaggcgaggaccctgacgcgaccgttataggcgtgatgccgccgcttgaagtcggagac
agcttcagcgcggaggtgctgatggaggaacaccgcgagtacggccatcagtaccgcgtg
ctgaatatggtgctggaggcgcagcccgccgacctgacagaggcaggggtagcggcctat
ctcgaagcccgcgtgggaggagtgggcaaggtgctggccggacggatcgcccgaactttt
gggccagccaccttcgacgtgctggagcaggagccggagaaattgcttcaggtaccgggt
gtcacggcctcaacgctgcacaagatggtgtcgagttggtctcaacagggcttggagcgc
cggttgctcgcgggactgcaagggctagggctgagtatctcgcaggcccagcgggccgtg
aagcacttcggcgaggcggcgctcgagcggctgcaagcagacctctttgcgctgaccgaa
gtagaggggattggctttctgaccgctgaccggctgtggcaggcgcaggggggggcgcag
gatgatccccgccgcctgaccgccgccgcggtgtatgcgcttcagcaggccgggcagcag
ggcgggcatgcctttttgccccgtgcccgcgccgagcggggcgtgctgcactacacccgc
gtctcacccgaacaggcgcggctcgcggtggagacggccaccgaactgggacgcctcgcg
gatgaccctacgcccgcaggggagagccgcatctatctgccccatgtcttgcggaccgag
aaaaaactcgcggggctgatccgcacgctgctggccacgccgcccgctggagcggaatgg
gcggtgccggttggcgcggcgcagggtctttcagaagaacaggcgcgggtgctgcaactt
ctcgaagatcatcgcctggtggtgctgaccggtggccccggtaccggcaaaagcaccgcc
acccgggcagttgcggatctggccgagcggctggggctggaggttggcctctgcgccccg
accggcaaggcggcccggcgtctgggtgaggtgaccgggcgccctgcctccaccattcac
cgcttgctggggtatggcccggcggggttccggcacaaccacctcgaacccgcgccgtat
gacctcctgattgtggacgaggtgagcatgacgggagacgcgctcatgctctcgctgctc
gccgccgtggcgccgggggcacgggtgctgctggtgggcgacaccgatcagctccccccg
gtcgactcggggttgccgctgctcgcgattgcccagacagcccccaccgttcgcctgtcc
acggtgtaccgccaggctgccgagaatccgatcatccgcgcggcccacggcctgttgcac
ggccaggccccgtcctggggcgatccgcgtctcgacctcaccgagacggaacccgatgtg
ggtgcccgccgcgtggccctgatggtccgcgacctgggagggccggggcgggtgcaggtc
ctcacgccgatgcgcaaggggccgctgggggtcgaaacgctcaaccgccacctccaggcc
ctctttaaccccggcgagggtggtacccggattgccgacggcgaggcgcggcccggtgac
gtggtcgtgcagaccaaaaacgactatcagaacgaggtcttcaacggcaccgttggcacg
gtcctcaaggccgaggggggccgcctcaccgtggattttgacggcaatatcgttgaactg
gccggtgccgaactgttcaatctgcaactcggctatgccctgaccgttcaccgcgcacag
ggcagcgagtggccaacggtcctcggggtgctgcacgaggttcacatgccgatgctctcg
cgcaatctcgcctacaccgccctgacccgcgcccgcgaacgtttcttggccgtgggttcg
gcttccgcctgggagaaggccgccgggcggcagcgagaggaacgcaacacggcgctgctg
gagcggattcggaggcggtag

DBGET integrated database retrieval system