KEGG   Deinococcus geothermalis: Dgeo_0882Help
Entry
Dgeo_0882         CDS       T00353                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
dge  Deinococcus geothermalis
Pathway
dge00860  Porphyrin and chlorophyll metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
Module
dge_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dgeo_0882
Enzymes [BR:dge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dgeo_0882
Exosome [BR:dge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgeo_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Trp_syntA Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: ABF45184
JGI: Dgeo0882
UniProt: Q1J000
Position
944069..945052
Genome map
AA seq 327 aa AA seqDB search
MLDRPRRLRRTAGLRALMREVTLTPQNFIHPMFVHEQDTEVPIATMPGVSRHSVRGAVEQ
ARIARELGITSVILFGIPDEKDPEGSQAYAEDGVIQRAVSAIKAELPDLTVIADTCLCEY
TDHGHCGPLCQTGDGDWTVDNDAALELLARTAVSQARAGADVVAPSAMMDGQVGAIRAAL
DAAGFEHVPVMSYAVKYASAYYGPFRDAAGSTPSVGNRASYQMDPAGGEREALREARLDV
AQGADYLMVKPALAYLDILKLLRETFDLPLVAYNVSGEYALVKAAVQAGYMDERRTVLET
LTGMRRAGADAIITYHALDAARWLRGE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttggaccgtccccgccggttgcgccgtaccgctggcctgcgcgccctgatgcgcgag
gtgaccctgacgccccagaacttcattcaccccatgttcgtgcacgagcaggacacggag
gtgcccatcgccaccatgccgggtgtgagccgccacagtgtgaggggggctgtggaacag
gcgcgtatcgcccgtgagctgggcatcaccagcgtgattctgttcgggattcccgacgag
aaggaccccgaggggagccaggcctacgccgaggatggcgtgattcagcgagcagtgagc
gccatcaaagccgagttgcctgacctcaccgtcatcgctgacacctgtctgtgtgaatac
accgaccacgggcactgcggaccgctgtgtcagacgggggacggcgactggacggtggac
aacgacgccgccctcgagctgctggcccggaccgcggtgtcgcaggcgcgagcgggggcg
gacgtggtggcccccagcgcaatgatggacgggcaggtaggtgcgattcgtgcggccctc
gacgcggcgggctttgagcacgttccggtgatgagctacgccgtcaaatacgccagtgcc
tactacggtccctttcgggatgcggcgggcagcacgcccagcgtcgggaaccgggcgtca
taccagatggacccggcgggaggcgagcgtgaggcgctgcgggaagcccggctcgacgtg
gcccagggtgcggattacctgatggtgaagcccgccctggcctacctcgacatcctgaag
ttgctgcgcgagacgttcgacctgcccctggtcgcctacaacgtcagcggcgagtacgcg
ctggtcaaggccgcggtgcaggctgggtacatggacgagcggcgaaccgtcctcgaaacc
ctcacggggatgcgtcgggcgggagcggacgcgatcatcacctaccacgcgctggacgcc
gcgcgctggctcaggggcgagtaa

DBGET integrated database retrieval system