KEGG   Deinococcus geothermalis: Dgeo_0888Help
Entry
Dgeo_0888         CDS       T00353                                 

Definition
(GenBank) succinate dehydrogenase, cytochrome b subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dge  Deinococcus geothermalis
Pathway
dge00020  Citrate cycle (TCA cycle)
dge00190  Oxidative phosphorylation
dge00650  Butanoate metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
Module
dge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dge_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dge_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dgeo_0888
   00650 Butanoate metabolism
    Dgeo_0888
  Energy metabolism
   00190 Oxidative phosphorylation
    Dgeo_0888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS VirB8
Motif
Other DBs
NCBI-ProteinID: ABF45190
JGI: Dgeo0888
UniProt: Q1IZZ4
Position
complement(949354..949731)
Genome map
AA seq 125 aa AA seqDB search
MIRARTLTDARQQSHSNAELNWWIFMRISGLILVFLILGHIYMTFIQVSESDATFDAVVA
KLQNPAWKFYDWLILLLAMLHGVNGARYSIEDYVRSRPNRAWVKGIFYTICAVIFLLGTV
GLFSI
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgcgcgcaccctcaccgatgctcggcagcagtcacactccaacgccgagctg
aactggtggatcttcatgcggatcagcggcctgattctggtcttcttgatcctgggccac
atctacatgacctttatccaggtcagcgagtcggacgccacctttgacgcggtggtcgcc
aagcttcagaacccagcctggaagttctacgactggctgattctgctgctggcgatgctg
cacggcgtcaacggcgcccggtactccattgaggactatgtgcgttcgcgccccaaccgc
gcctgggtcaagggtatcttctataccatctgcgccgtgattttcttgctcggcacagtt
ggcctgttctccatctga

DBGET integrated database retrieval system