KEGG   Deinococcus geothermalis: Dgeo_0944Help
Entry
Dgeo_0944         CDS       T00353                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
dge  Deinococcus geothermalis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Dgeo_0944
  Amino acid metabolism
   00380 Tryptophan metabolism
    Dgeo_0944
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Dgeo_0944
Enzymes [BR:dge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Dgeo_0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1008706..1009896
Genome map
AA seq 396 aa AA seqDB search
MSLPECTLPLGDPAFIRDPYPRLAQLREATPAFRDPALNRVFLTRYADIAAVLRDRRFGR
SVLHRYTRDELGWPPPDPRQAHFDAFNNNHLLESEGAKHTRLRSLVGLAFTPRRVEALTG
RIEALLERQLASLGRAGGFDLVADYAEPLPVTVIAELLGVPESERGHLRPWSAAIVRLYE
PTYTPQEQAAAERAVLDFSTLLRELAGARRAEPRDDLITALVQVEAEGDRLTEQELIDTC
ILLLNAGHEASVNGLAAGVLALLRERPHWEELVRGAKHADSLPLFRTALEELLRFDTPLP
LFERYVLEDLTLHGAPLHPGEKVGLLYASGNRDPRRFERPDQLDLTRDPNPHLTFGLGTH
YCLGAPLARLELALSLRALARTFPELRLRDPEANPE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcctgaatgcacgctgcccctgggcgatccggccttcatccgtgatccctac
ccgcggctggcgcagctccgcgaggccacgcccgccttccgtgacccggcgctcaaccgg
gtgttcctgacccgctacgccgacatcgccgccgtgctgcgcgaccgccgcttcgggcgc
agcgtgctgcaccgctacacgcgcgacgagctgggctggccgccgccggatcctcgccaa
gcacacttcgacgccttcaacaacaaccatctgctggagagcgagggggccaaacatacc
cggctgcgctcgctggtgggcctggccttcaccccccggcgggtggaggcgctcacgggg
cgcatcgaagcgctgctggagcggcaacttgccagcttgggccgggcgggcggctttgat
ctggtggcggactacgccgaaccgcttcccgtgacggtgatcgcggagctgctgggcgtg
cctgagtctgagcgcggccatctccgcccctggtcggcggccatcgtgcgcctgtacgag
ccgacgtatacaccgcaggagcaggctgcggccgagcgggcggtgctggacttcagcact
ctgctgcgggagctcgcgggggcgcggcgagccgagccgcgggacgacctgattacggcg
ctggtgcaggtggaggcggagggggaccgcctgaccgagcaggagctgatcgatacctgc
atcctgctgctgaacgccggacacgaggccagtgtgaacggcttggcggcgggcgtgctg
gccctgctgcgggagcggccgcactgggaggagctggtgcggggtgcaaagcacgcagac
agcctgccgcttttccgcaccgcgctggaagaactgctgcgctttgatacgccgctcccc
ctcttcgagcggtacgtgctggaggacctgaccctgcatggcgcaccgctgcacccgggc
gagaaggtcggcttgttgtacgcgagcggcaaccgcgacccccgccgcttcgagcggccc
gaccagttggatctcacccgtgaccccaatccgcacctcaccttcggcctaggcacgcac
tactgtctgggtgcgcccctggcccgcctcgaactcgcgctcagcctgcgggcactcgcg
cggacctttccagaactgcgcctgcgtgatccggaggccaatcccgagtaa

DBGET integrated database retrieval system