KEGG   Deinococcus geothermalis: Dgeo_0944Help
Entry
Dgeo_0944         CDS       T00353                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
dge  Deinococcus geothermalis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dge00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:dge00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:dge00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1008706..1009896
Genome map
AA seq 396 aa AA seqDB search
MSLPECTLPLGDPAFIRDPYPRLAQLREATPAFRDPALNRVFLTRYADIAAVLRDRRFGR
SVLHRYTRDELGWPPPDPRQAHFDAFNNNHLLESEGAKHTRLRSLVGLAFTPRRVEALTG
RIEALLERQLASLGRAGGFDLVADYAEPLPVTVIAELLGVPESERGHLRPWSAAIVRLYE
PTYTPQEQAAAERAVLDFSTLLRELAGARRAEPRDDLITALVQVEAEGDRLTEQELIDTC
ILLLNAGHEASVNGLAAGVLALLRERPHWEELVRGAKHADSLPLFRTALEELLRFDTPLP
LFERYVLEDLTLHGAPLHPGEKVGLLYASGNRDPRRFERPDQLDLTRDPNPHLTFGLGTH
YCLGAPLARLELALSLRALARTFPELRLRDPEANPE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcctgaatgcacgctgcccctgggcgatccggccttcatccgtgatccctac
ccgcggctggcgcagctccgcgaggccacgcccgccttccgtgacccggcgctcaaccgg
gtgttcctgacccgctacgccgacatcgccgccgtgctgcgcgaccgccgcttcgggcgc
agcgtgctgcaccgctacacgcgcgacgagctgggctggccgccgccggatcctcgccaa
gcacacttcgacgccttcaacaacaaccatctgctggagagcgagggggccaaacatacc
cggctgcgctcgctggtgggcctggccttcaccccccggcgggtggaggcgctcacgggg
cgcatcgaagcgctgctggagcggcaacttgccagcttgggccgggcgggcggctttgat
ctggtggcggactacgccgaaccgcttcccgtgacggtgatcgcggagctgctgggcgtg
cctgagtctgagcgcggccatctccgcccctggtcggcggccatcgtgcgcctgtacgag
ccgacgtatacaccgcaggagcaggctgcggccgagcgggcggtgctggacttcagcact
ctgctgcgggagctcgcgggggcgcggcgagccgagccgcgggacgacctgattacggcg
ctggtgcaggtggaggcggagggggaccgcctgaccgagcaggagctgatcgatacctgc
atcctgctgctgaacgccggacacgaggccagtgtgaacggcttggcggcgggcgtgctg
gccctgctgcgggagcggccgcactgggaggagctggtgcggggtgcaaagcacgcagac
agcctgccgcttttccgcaccgcgctggaagaactgctgcgctttgatacgccgctcccc
ctcttcgagcggtacgtgctggaggacctgaccctgcatggcgcaccgctgcacccgggc
gagaaggtcggcttgttgtacgcgagcggcaaccgcgacccccgccgcttcgagcggccc
gaccagttggatctcacccgtgaccccaatccgcacctcaccttcggcctaggcacgcac
tactgtctgggtgcgcccctggcccgcctcgaactcgcgctcagcctgcgggcactcgcg
cggacctttccagaactgcgcctgcgtgatccggaggccaatcccgagtaa

DBGET integrated database retrieval system