KEGG   Deinococcus geothermalis: Dgeo_0952Help
Entry
Dgeo_0952         CDS       T00353                                 

Definition
short-chain dehydrogenase/reductase SDR
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dge  Deinococcus geothermalis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dge00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:dge00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1018784..1019560)
Genome map
AA seq 258 aa AA seqDB search
MPSQEHQEARVALVTGGSSGIGLAIAQRLQADGLKVAVLDLDRPQAREGAEQNGFTFIGA
DLSRREDCRRAVEETVAALGGLDVLVNNAGFQHIDPIADFPEDTWDSMLRVMLTAPFLLT
KYAWGYLTRSGQGRVVNIASIHGQVASPFKSAYISAKHGLIGLTRTAALEAGEQGFTVNA
ICPGYVRTPLVEGQIADQARTRGLSEQEVEQRVMLEPAAIKRLLAPEDVAALASYVVSPA
AWGMTGAVLDLDLGWTAR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccaggaacatcaggaagcccgcgtcgccctcgtcacgggcgggagcagcggc
atcggcctcgccatcgcgcagcggctgcaggccgacgggttgaaggtggccgtgctggac
ctcgaccgcccgcaggcacgcgagggggcagagcagaatggcttcacctttatcggcgcc
gacctttcccgccgcgaggactgccgccgcgcagtggaggaaacggtggccgcgctggga
ggcttggacgtgctggtcaacaacgcgggctttcagcacatcgaccccatcgcggacttt
cccgaagacacctgggacagcatgctgcgcgtgatgctgaccgcgccgtttttgctcacc
aagtacgcctgggggtacctcacgcgctcggggcagggccgcgttgtgaatatcgcctcc
atccacgggcaggttgccagccccttcaagagtgcctatatcagcgccaagcacgggctg
atcggcctgacgcgcacggcggcgctggaggcgggcgagcagggcttcaccgtgaacgcg
atctgcccgggctacgtccgcacgcccctggtggagggccagatcgcggaccaggcccgc
acccgcggcctcagcgagcaggaggtcgagcagcgggtgatgctcgaacccgccgccatc
aagcggctgctggcgccggaggacgtggcggccctcgcgagctacgtggtcagcccggcc
gcctggggcatgacgggcgcggtgctggacctcgacctggggtggacggcgcgctaa

DBGET integrated database retrieval system