KEGG   Deinococcus geothermalis: Dgeo_0992Help
Entry
Dgeo_0992         CDS       T00353                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dge  Deinococcus geothermalis
Pathway
dge00330  Arginine and proline metabolism
dge00332  Carbapenem biosynthesis
dge01100  Metabolic pathways
dge01130  Biosynthesis of antibiotics
dge01230  Biosynthesis of amino acids
Module
dge_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dgeo_0992
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Dgeo_0992
Enzymes [BR:dge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dgeo_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABF45292
JGI: Dgeo0992
UniProt: Q1IZP2
Position
1064279..1065370
Genome map
AA seq 363 aa AA seqDB search
MRVVLKLGTSVLTAGTDRLHRPRLVDLLRGIAEVRAAGHEVVLVTSGAVLAGWEALGFPP
RERTLAEKQLLAAVGQGRLMHLYASIADLYGMPVAQVLLTADDFRDRTRYLNARTTLEGC
LTRGVLPIINENDTVAVEQIKVGDNDTLSAFVANLVEADLLVILTDAPGLYTADPRIDPT
ATLIPVVERVTPEVWALAGGAGSHRGTGGMHTKLQAAEIATRAGTPVVIAPGDAENALAR
IVRGEALGTRFLAHGSRLEARKRWILAEIATGRLLLDEGAVRAVRERGGSLLPAGITTVH
GPFERGHTVRLLAPDGSEVARGLTRYRADDLKRIAGRHSRDIEAVLGFTYGPEAVHRDDL
VRL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgttctcaagctcggcaccagtgtcctcacggcggggacagaccgcctgcac
cgcccccggctggtcgacctgctgcgcgggatagcggaggttcgcgcggccgggcacgag
gttgtgctggtgaccagcggcgcagtgctggctgggtgggaggcgctgggatttcccccg
cgcgagcggaccctggcagaaaagcagcttctcgcagcggttgggcaggggcggctgatg
catctgtacgccagcatcgccgacctgtacggcatgccggttgcgcaggtgctcctgact
gccgacgacttccgcgaccgcacccgctacctgaatgcccgtaccacgctggagggctgc
ctcacgcgcggcgtgctgcccatcatcaacgagaatgatacggtggccgtcgagcagatc
aaggtgggcgacaacgataccctctccgccttcgtcgccaatctggtcgaggctgacctg
ctggtcatcctcaccgacgcccccggcctctacaccgccgatccgcgcatcgaccccacc
gcgaccctgatccccgttgtggagcgggtcacgcccgaggtgtgggcgctcgcggggggg
gcgggcagccaccgcggtacgggcgggatgcacaccaagctccaggctgctgagatcgcg
acccgggccggaacgccggttgtgattgcccccggtgacgccgagaatgccctcgcccgg
atcgtacgcggcgaggccctgggcacgcgcttcctcgcgcacggctcccgcctggaggcc
cgcaaacgctggattctggccgaaattgcgaccggccgcctcctgctggacgagggcgcg
gtgcgggcggtgcgcgaacggggcggcagcctgctgcctgctggaatcaccaccgtccac
ggccccttcgagcgcggccacaccgtccgtctcttggctcctgatggcagcgaggttgcc
cgcggcctgacccgctaccgtgccgacgacctgaaacggatcgcggggcggcattcgcgc
gacatcgaggcggtgctggggtttacctatgggccggaggcggtgcaccgggacgatctg
gtgcggttgtag

DBGET integrated database retrieval system