KEGG   Deinococcus geothermalis: Dgeo_1024Help
Entry
Dgeo_1024         CDS       T00353                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dge  Deinococcus geothermalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dgeo_1024
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dgeo_1024
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dgeo_1024
Enzymes [BR:dge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dgeo_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1095724..1096968
Genome map
AA seq 414 aa AA seqDB search
MSLTLPTYPQPDARGRYGRFGGRYVPETLIPALDELERAYLAAKADPAFLNELDRLLREY
VGRPSPLYLAQRLTEYAGGAKIYLKREDFNHTGAHKINNCLAQALLAKRMGKRRVIAETG
AGQHGVASATAAALLGLECIVYMGAEDIRRQAMNVFRMRLLGAEVREVTSGTSTLKDATN
EAIRDWVTNVRDTFYILGSVVGPHPYPAMVRDFQSVIGEEVKVQLQAAEGRTVPDAIVAC
VGGGSNAIGIFAPYAYLPAGERPRLIGTEAAGEGVDSGKHAASVAGGRVGVLHGSLMYLL
NDAEGQIVPPHSISAGLDYPGIGPEHCHYSETGVAEYVPVTDAQALEGLQLLTRLEGIIP
ALESAHAIYYAVQLARKLGPEKVIVVNLSGRGDKDVAEVMRLLDLDAKPQEVTA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgacccttcccacctacccgcagccagacgcgcgcgggcggtacgggcgcttt
ggcgggcgctatgtgcccgagacgctcattccggccctcgacgagctggagcgggcgtat
ctggccgccaaggccgatcccgccttcctcaatgagttggaccgccttctgcgcgagtac
gtgggccgtcccagccccctctacctcgcgcagcgcctcaccgaatacgcgggcggcgcc
aagatctacctcaagcgcgaagacttcaaccacaccggcgcccacaaaatcaacaactgc
ctggcgcaggccctcctcgctaagcgcatgggcaaacgccgggtgatcgcggagacgggg
gctggacagcacggtgtggccagcgccaccgccgcggccctgctgggcttggaatgcatc
gtgtacatgggcgccgaggacatccgccgccaggcgatgaatgtcttccggatgcggctg
cttggggctgaggtccgcgaggtgaccagcggtaccagcaccctcaaagacgccaccaac
gaggccatccgcgactgggtgaccaatgtgcgcgacaccttttatattctcggcagcgtt
gtggggccgcacccctatcccgcgatggtccgcgatttccagagcgtgatcggggaagag
gtcaaagtgcagctccaggccgccgagggccgcacggtgcccgacgccatcgtggcctgt
gtgggcgggggcagcaacgccatcggcatcttcgcgccctatgcctacctgcccgctggg
gaacggccccgcttgatcggcactgaggccgctggggaaggcgtagacagcggcaagcac
gcggccagcgtggcgggcgggcgagtcggcgtgctccacggctcgctgatgtacctgctg
aacgacgccgaaggccagatcgttcctccgcactccatcagtgccggcctggattacccc
ggtatcggccccgaacactgccactacagcgagacgggagtggctgagtacgtcccggtc
accgacgcgcaggcgctggaaggcttgcagctcctcacccggttggagggcatcattccc
gccctggagagtgcccacgccatctattacgccgtgcaactcgcgcggaaactgggccca
gaaaaggtcatcgtggtgaacctgtcgggccgcggcgataaggatgtggccgaggtgatg
cgccttcttgacctggacgcgaagccgcaggaggtgaccgcatga

DBGET integrated database retrieval system