KEGG   Deinococcus geothermalis: Dgeo_1025Help
Entry
Dgeo_1025         CDS       T00353                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dge  Deinococcus geothermalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dgeo_1025
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dgeo_1025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dgeo_1025
Enzymes [BR:dge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dgeo_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1096965..1097765
Genome map
AA seq 266 aa AA seqDB search
MTATRTRGAERIHAAFERAKAEGRAAFIPFLTAGYPSAAQFPGVADTLLAQADLLEVGIP
YSDPLGDGPTIQRASEQALAGGTSTRRTLKLVKELRGRHDTPMVIMTYVNPIYAVGPREF
MRLSQEAGVDGLILPDLPPDQDIEIADLAAEYGLAVTFLIAPTSTPERVKLVADACTGFL
YAVSVTGVTGTREGSALGEVPAMLALARQYARVPIAVGFGVKDRQTAHQVAQVADGVVVG
SAFINAVRDGQDVAALAAEIAAGCRR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacccgcacgcgcggggccgagcgcatccacgcggcctttgaacgggcgaag
gcggagggccgcgccgcttttatcccctttctcacggctgggtacccgagtgccgcgcag
tttcctggggtggccgacaccctgctcgcgcaggccgatctcctggaagttggcatcccc
tacagcgatccgctgggtgacggccccaccattcagcgggccagtgaacaggcgctggcg
ggcggcacgagcacccggcgcacgctgaaactggtgaaagagctgcgcgggcggcacgac
acgcctatggtgatcatgacctatgtgaacccgatctacgcggtcggcccccgcgagttt
atgcggttgagccaggaagcgggcgtagacggcctgatcctccccgacctgccccccgat
caggacatcgagatcgcggacctggccgccgaatacggtctggctgttactttcctgatc
gcgccgacgagcacacccgagcgggtcaaactggtagcggacgcctgcacgggtttcctc
tacgcggtcagcgtgacgggcgtgaccgggacgcgggagggttcggccctgggtgaggtg
cccgcgatgctggccctggcccgccagtatgcccgtgtgcccatcgcggtcggcttcggt
gtcaaggaccggcagaccgcccaccaggtcgcgcaggtcgctgacggggtggtcgtgggg
agcgcctttatcaacgccgtgcgggacggacaggacgtggctgcgctcgccgccgagatc
gcagcgggatgccgcaggtag

DBGET integrated database retrieval system