KEGG   Deinococcus geothermalis: Dgeo_1135Help
Entry
Dgeo_1135         CDS       T00353                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dge  Deinococcus geothermalis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dgeo_1135 (tpiA)
   01230 Biosynthesis of amino acids
    Dgeo_1135 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_1135 (tpiA)
   00051 Fructose and mannose metabolism
    Dgeo_1135 (tpiA)
   00562 Inositol phosphate metabolism
    Dgeo_1135 (tpiA)
Enzymes [BR:dge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dgeo_1135 (tpiA)
Exosome [BR:dge04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dgeo_1135 (tpiA)
  Exosomal proteins of bladder cancer cells
   Dgeo_1135 (tpiA)
  Exosomal proteins of melanoma cells
   Dgeo_1135 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1204809..1205543
Genome map
AA seq 244 aa AA seqDB search
MSQPLLALNWKMNKTPSEARAWAADLSSALTPGNAELAVLAPAIDLPVLAGALPAGVALG
GQDVSRFAAGAYTGEISAAMLRDVGATYVIVGHSERRTYHAETDAVVAAKARQAQAAGLI
PIVCVGESLDVRERGAQVDFTLDQLRGSTEGVGENLIVAYEPVWAIGTGKTATADDAEEL
AAAIREALAGLYTAEARSFRILYGGSVKPDNIASICAQPNVNGALVGGASLNVADVVAMS
DALR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacctctcctcgcgctcaactggaaaatgaacaagacgccctcggaagcccgc
gcctgggccgccgacctctcctctgccttgacgccgggcaacgccgaactcgcggtgctg
gctccggcgatcgacctgccggtgctggcgggggccttgcccgcgggcgtggcgctgggc
gggcaggacgtctcgcgctttgcggcgggggcctacaccggcgagatcagcgccgctatg
ctgcgggacgtgggcgcgacctatgtgatcgtgggccacagcgagcgccgcacctatcac
gcggaaaccgacgcggtggtcgccgccaaggcgcggcaggcgcaggcggcaggcctgatt
ccgatcgtctgcgtgggcgaaagcctggacgtgcgcgagcgcggcgcgcaggtggacttc
acgctcgaccagctgcgtgggagcaccgagggcgtgggtgaaaacctgattgtcgcctac
gaacccgtctgggccatcggcaccgggaagaccgccacagccgatgacgccgaggagctg
gctgccgccatccgcgaggccttggcgggcctgtacaccgcagaggcccgcagcttccgg
atcctctacggcggcagcgtgaagccggacaacatcgcctcgatctgcgcacaacccaac
gtcaacggtgcgctggtgggcggtgccagcctgaacgtggccgacgtcgtcgcgatgagt
gacgccctgcgctaa

DBGET integrated database retrieval system