KEGG   Deinococcus geothermalis: Dgeo_1135Help
Entry
Dgeo_1135         CDS       T00353                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dge  Deinococcus geothermalis
Pathway
dge00010  Glycolysis / Gluconeogenesis
dge00051  Fructose and mannose metabolism
dge00562  Inositol phosphate metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
dge01230  Biosynthesis of amino acids
Module
dge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dge_M00002  Glycolysis, core module involving three-carbon compounds
dge_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_1135
   00051 Fructose and mannose metabolism
    Dgeo_1135
   00562 Inositol phosphate metabolism
    Dgeo_1135
Enzymes [BR:dge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dgeo_1135
Exosome [BR:dge04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dgeo_1135
  Exosomal proteins of bladder cancer cells
   Dgeo_1135
  Exosomal proteins of melanoma cells
   Dgeo_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3168
Motif
Other DBs
NCBI-ProteinID: ABF45432
JGI: Dgeo1135
UniProt: Q1IZA2
Position
1204809..1205543
Genome map
AA seq 244 aa AA seqDB search
MSQPLLALNWKMNKTPSEARAWAADLSSALTPGNAELAVLAPAIDLPVLAGALPAGVALG
GQDVSRFAAGAYTGEISAAMLRDVGATYVIVGHSERRTYHAETDAVVAAKARQAQAAGLI
PIVCVGESLDVRERGAQVDFTLDQLRGSTEGVGENLIVAYEPVWAIGTGKTATADDAEEL
AAAIREALAGLYTAEARSFRILYGGSVKPDNIASICAQPNVNGALVGGASLNVADVVAMS
DALR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacctctcctcgcgctcaactggaaaatgaacaagacgccctcggaagcccgc
gcctgggccgccgacctctcctctgccttgacgccgggcaacgccgaactcgcggtgctg
gctccggcgatcgacctgccggtgctggcgggggccttgcccgcgggcgtggcgctgggc
gggcaggacgtctcgcgctttgcggcgggggcctacaccggcgagatcagcgccgctatg
ctgcgggacgtgggcgcgacctatgtgatcgtgggccacagcgagcgccgcacctatcac
gcggaaaccgacgcggtggtcgccgccaaggcgcggcaggcgcaggcggcaggcctgatt
ccgatcgtctgcgtgggcgaaagcctggacgtgcgcgagcgcggcgcgcaggtggacttc
acgctcgaccagctgcgtgggagcaccgagggcgtgggtgaaaacctgattgtcgcctac
gaacccgtctgggccatcggcaccgggaagaccgccacagccgatgacgccgaggagctg
gctgccgccatccgcgaggccttggcgggcctgtacaccgcagaggcccgcagcttccgg
atcctctacggcggcagcgtgaagccggacaacatcgcctcgatctgcgcacaacccaac
gtcaacggtgcgctggtgggcggtgccagcctgaacgtggccgacgtcgtcgcgatgagt
gacgccctgcgctaa

DBGET integrated database retrieval system