KEGG   Deinococcus geothermalis: Dgeo_1142Help
Entry
Dgeo_1142         CDS       T00353                                 

Definition
PfkB protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dge  Deinococcus geothermalis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dgeo_1142
Enzymes [BR:dge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dgeo_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1214013..1214945)
Genome map
AA seq 310 aa AA seqDB search
MKFFVIGDVTVDHLYHLDRLPAPGEEVAPTRATMKPGGAGGTISVTLARLGHSVTLAARV
GDDPFAEYALASVRESGVLQAAIQIDPEHLTSTITVMQTPDGQRAMISDGAANRQLDPAK
LKKKDIEGADALIVSAYSLTEGPQREYTLKAIETAKKAKKPVPVFIDLGTGAVNKVGTDL
IENVIGADYLTLNQHELLALTDTTSISAALAQLGDAGARRVIVKVGRMGSIVWTPTETEL
VDPIKPEGRVVDSTGAGDTFTAAFAHAVLTGHSLPQAARIGNAAGALAATRVGAQARPIT
LADLEAALAR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttttttgttatcggtgatgtcaccgtcgatcacctctatcaccttgaccgcttg
cccgctcccggcgaggaagtcgcccccacccgcgccaccatgaaacccggtggggcaggg
ggcaccatcagcgtgacgctggcgcggctcggccatagcgtcaccctcgccgcacgtgtc
ggtgatgatcccttcgccgagtacgcactggcgagtgtccgtgagagcggcgtcttgcag
gcagccatccagatcgaccccgagcatctcaccagcaccatcacggtgatgcagacgccc
gatggccagcgcgcgatgatcagcgacggggccgccaaccgccagctcgacccggccaag
ctgaaaaaaaaggacatcgagggtgccgacgccctgatcgtgagtgcctacagcctgacg
gaagggccgcagcgcgagtacaccctcaaggccattgagacggccaagaaggccaaaaaa
cccgttccggtctttatcgatctgggaaccggggctgtgaacaaggttggcactgacctg
atcgagaatgtgatcggcgccgactacctgaccctcaaccagcatgagctgctggccctg
accgacaccaccagcatcagcgcggcgctggcgcagctgggcgacgcgggtgcgcgccgc
gtgatcgtgaaggtgggccgaatgggcagtatcgtctggacacccaccgagaccgagctg
gtcgatcccatcaagcccgaaggtcgggtcgtggattccaccggtgcaggtgataccttt
accgcagcctttgctcatgcggtcctcacgggccactccctcccgcaggctgcccgcata
ggcaacgcggctggagcgctcgccgccacccgcgtcggcgcgcaggcccgcccgatcacc
cttgctgacctagaagctgctctggcccgctag

DBGET integrated database retrieval system