KEGG   Deinococcus geothermalis: Dgeo_1287Help
Entry
Dgeo_1287         CDS       T00353                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
dge  Deinococcus geothermalis
Pathway
dge00630  Glyoxylate and dicarboxylate metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01200  Carbon metabolism
Module
dge_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dgeo_1287
Enzymes [BR:dge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Dgeo_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABF45583
JGI: Dgeo1287
UniProt: Q1IYV1
Position
complement(1366534..1367865)
Genome map
AA seq 443 aa AA seqDB search
MTPADPRLHSPRTHAEILEKTWKTEERWQGIRRNYSADEVVRLRGSLPIEHTLARHGAQK
LWRLMKEEPFVNALGALTGNQAVQQVKAGLKAIYLSGWQVAADANNAGQMYPDQSLYPAS
SVPDVVRRINNALRRADQIQHSEGKDDIDYFVPIVADAEAGFGGPLNAFELMKAMIEAGA
AGVHFEDQLASEKKCGHLGGKVLVPTSQFIRTLNAARLAADVSGVPTVLIARTDADAANL
LTSDIDDNDKPFTTGERTPEGFFYVRPGIEQAISRALAYAPYADVLWCETSVPNLEDARR
FAEAVHAKFPGKLLAYNCSPSFNWKKNLDDETIAKFQRELGAMGYKFQFITLAGFHSLNY
SMFELAYGYARNQMTAFVELQEKEFAAQERGFTAVKHQREVGTGYFDLVSTAAGGGQSST
TALAGSTEAQQFHGEKEVAAAHD
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgccgatcctcgcctgcatagtccccgcacccacgccgaaattctggaaaag
acctggaagaccgaggaacgctggcaggggatccgccgcaactactccgccgacgaggtg
gtgcggttgcgcggcagcctgcccatcgagcacaccctggcccggcacggggcgcaaaag
ctctggcgactgatgaaggaagaacccttcgtgaatgcgctgggggccctcactggcaat
caggctgtgcaacaggtgaaagcgggcctgaaggcgatctacctcagtggctggcaggtg
gccgctgacgccaacaatgccgggcagatgtaccccgaccagagcctctacccggcctcc
tcggtgccggacgtggtgcgccgcatcaacaacgcgctgcgccgcgccgatcagattcag
cactcggaaggcaaggatgacatcgactacttcgtgcccattgtggctgacgcggaagcg
ggcttcggtggtcccctcaacgcctttgaactcatgaaggcgatgattgaggcaggcgca
gcgggcgtgcactttgaggaccagctcgcctccgagaagaagtgcgggcacctgggcggc
aaggtgctcgtgcccacctcacagttcatccgcaccctgaacgccgcgcgcctcgccgcc
gacgtgtcgggcgtccccaccgtcctgatcgcccgtaccgatgccgatgccgccaacctg
ctcaccagcgacatcgacgataacgacaagcccttcacgaccggcgagcgcaccccggaa
ggcttcttctacgtccgccctgggatcgagcaggcgatcagccgcgccctcgcctacgcc
ccctacgccgatgtgctgtggtgcgaaacgagcgtccccaacctcgaggacgcccgccgc
tttgccgaagccgtccacgccaagtttcccggcaagctgctcgcctacaactgttctccc
tcctttaactggaagaagaacctcgacgacgagacgattgccaaattccagcgcgaactg
ggcgcgatgggctacaagttccagttcatcacgctggcgggcttccatagtctcaactac
tcgatgttcgagctggcctacggctatgcccgaaaccagatgacggccttcgtggagctt
caagaaaaggaatttgcggcccaggagcggggcttcaccgccgttaagcaccagcgcgag
gtgggcactggctacttcgacctcgtcagcaccgcagcaggcggcggccagagcagcacc
actgcactggcaggcagtaccgaggcgcagcagttccacggggagaaggaggtggccgcc
gcccacgactga

DBGET integrated database retrieval system