KEGG   Deinococcus geothermalis: Dgeo_1513Help
Entry
Dgeo_1513         CDS       T00353                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dge  Deinococcus geothermalis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dgeo_1513 (recR)
DNA repair and recombination proteins [BR:dge03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dgeo_1513 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1606288..1606956
Genome map
AA seq 222 aa AA seqDB search
MKYPPSLVGLIRELSRLPGIGPKSAQRLAFYLFEQPREDIERLAGAILEAKRDLHTCPVC
FNITDAERCDVCSDPTRDQSVICVVEEPGDVIAIERSGEYRGLYHVLHGALSPMNGVGPD
RLQIRPLLPRVQDGMEVILATGTTVEGDATALYLQRLLEPLGAVVSRIAYGLPVGGALEY
ADEVTLGRALSGRRRVSEPASPPPPRRNDEEQDGAPARPPSH
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatccgccttcgctggtggggctgatccgggaactctcgcgcctgcccggcatc
gggccgaaaagcgcgcagcggctggccttttatctgttcgagcagccacgagaagacatc
gagcggctggccggagcaatcttggaggccaagcgcgacctgcacacctgcccggtctgt
ttcaacattaccgacgcggaacgctgtgacgtgtgcagcgaccccacgcgcgatcagagc
gtgatttgcgtggtggaagaacccggcgacgtgatcgccatcgagcgcagcggcgagtac
cgcgggctgtaccacgtgctgcacggcgccctaagtccgatgaacggcgtggggccggac
cggctgcagatccgccccctactgccgcgggtgcaggacggcatggaggtgatcctggcg
accggcacgacggtggagggcgacgcaaccgcgctctatctccagcgcctgctggagccg
ctgggtgcagtggtgagccgcatcgcctacgggctgccggtgggcggcgcgctggaatac
gccgatgaggtgacgctgggccgcgccctgagcggtaggcggcgggtgagtgaaccggcc
tccccgccaccgccccgccgcaacgatgaggagcaagacggcgctcccgctcggcccccg
tcccattag

DBGET integrated database retrieval system