KEGG   Deinococcus geothermalis: Dgeo_1587Help
Entry
Dgeo_1587         CDS       T00353                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dge  Deinococcus geothermalis
Pathway
dge00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01130  Biosynthesis of antibiotics
dge01230  Biosynthesis of amino acids
Module
dge_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dgeo_1587
Enzymes [BR:dge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dgeo_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABF45882
JGI: Dgeo1587
UniProt: Q1IY02
Position
complement(1688426..1689214)
Genome map
AA seq 262 aa AA seqDB search
MTGLPVTHFERVPGVLGRIVRERAADYADANTDLGPARPRAGRFRAALARPHLALIAEVK
RASPSEGAIAPLDPARAARAYAAGGAAAISVLTEPRHFDGNREALQAVVGAVELPVLRKD
FVVHPAMLREAADWGAAAALLMVSVLGEAVGAYLDMAHHLGLDALVEVHDERELEVALAS
GAQIIGVNNRDLTTLATNLAVSPRLIRRAREAGFGGVLVAESGYRTPADLESVRDLADAV
LVGTSLAASGDLTRAARELMTP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcctgccggtgacccactttgagcgcgtgccaggtgtcctgggccggattgtc
cgcgagcgcgccgccgattacgcggatgcgaacacggacctgggacccgcacgcccccgc
gccgggaggttccgcgcggccctcgctcgccctcacctcgccttgatcgcggaagtcaaa
cgggccagccccagcgagggtgcaatcgcgccgctcgacccagcccgcgccgctcgtgct
tatgcggcgggcggcgcggcggccatcagcgttctgaccgagccccggcacttcgacggc
aaccgggaggcgctgcaggcggtggtgggtgccgtcgagcttccggtcctgcgcaaggat
ttcgtcgtccatccagccatgctgcgtgaggcagccgactggggcgctgccgccgccctc
ctgatggtcagcgtgctgggcgaggcggtcggtgcgtatctggacatggcacaccacctt
ggcctcgacgcgctggtggaggtccacgacgagcgcgaactggaggtggccctcgcctcc
ggtgcccagatcatcggtgtcaacaaccgcgacctcaccacgctcgccaccaacctcgcc
gtcagtccgcggctaatccgccgggcacgcgaggcaggctttggcggcgtgctggtcgcg
gagagcggctaccgcacgcccgccgacctggagagcgtgcgtgacctggcagacgccgtg
ctggtcggcaccagtctggccgccagcggcgacctgacccgcgccgcgcgcgagctgatg
accccttga

DBGET integrated database retrieval system