KEGG   Deinococcus geothermalis: Dgeo_1637Help
Entry
Dgeo_1637         CDS       T00353                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dge  Deinococcus geothermalis
Pathway
dge00010  Glycolysis / Gluconeogenesis
dge00030  Pentose phosphate pathway
dge00051  Fructose and mannose metabolism
dge00052  Galactose metabolism
dge00680  Methane metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
dge01230  Biosynthesis of amino acids
dge03018  RNA degradation
Module
dge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_1637
   00030 Pentose phosphate pathway
    Dgeo_1637
   00051 Fructose and mannose metabolism
    Dgeo_1637
   00052 Galactose metabolism
    Dgeo_1637
  Energy metabolism
   00680 Methane metabolism
    Dgeo_1637
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dgeo_1637
Enzymes [BR:dge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dgeo_1637
Protein phosphatases and associated proteins [BR:dge01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dgeo_1637
Messenger RNA biogenesis [BR:dge03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dgeo_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABF45932
JGI: Dgeo1637
UniProt: Q1IXV2
Position
complement(1741762..1742772)
Genome map
AA seq 336 aa AA seqDB search
MTDIPHLSTHANPAGIKRLAVLTSGGDAPGMNAAIRAVVRTATYQGLEVVGVRRGFSGLH
RGDLRLIGPRDVANTIQRGGTILLTARSHTWRTPEGRARGAQHLRDWGVDGLIVIGGDGS
FHGAHLLQQEHGIPVIGVPGTIDNDLYGTDHTIGYFTAVETALDAVDKLRDTGASHERIF
VIEVMGRHAGHIALEVAVAGGAEEVFIPEDPKPVDGIVQIVQDSVAKGKASSIIIVAEGY
PGGALGVAQAIEVGTGLETRVSILGHIQRGGSPVSSDRVLASRLGEAAVYALMDGYSDVM
VGRRNGDISHTPLPETWEKRKDVSRDLYRCAKTLSV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacattccccacctgtccacccatgccaaccccgccggaatcaagcgcctggcc
gtcctgacaagtggtggcgacgcgccggggatgaacgccgccattcgcgccgtcgtccgc
actgccacctatcagggcctggaggtggtgggtgtgcgccggggcttttccggcctgcac
cgcggtgacctgcgcctgatcgggccaagagatgtggcgaacaccatccagcgcggcggc
accatcctgctcaccgcccgctcgcacacctggcgcacacccgagggccgcgctcgcggc
gcgcagcatctgcgcgactggggcgtggacggcctgatcgtgatcggcggtgacggcagc
tttcacggcgcgcacctcctccagcaggaacacggcatcccggtgatcggagttccgggc
accatcgacaatgacctctacggcactgaccacaccatcgggtacttcacggcggttgag
acagccctggacgccgtggacaaactgcgcgacaccggcgccagccacgagcgcatcttt
gtgatcgaggtgatgggccgccatgccggacacatcgcgttggaggttgcggtcgcgggc
ggcgccgaggaagtctttatccccgaagaccccaagccggtggacggcatcgtgcagatc
gtgcaggacagtgtggcaaagggcaaggccagttcgatcatcatcgtcgccgaggggtac
ccgggtggggcgctgggcgtcgcgcaggccatcgaggtgggcaccgggctggaaacgcgg
gtcagcatcctgggccacatccaacgtggcggctcaccggtgagcagtgaccgcgtcctg
gcaagccgtctgggagaagccgccgtctacgctctgatggatggatacagcgatgtgatg
gtgggccgccgcaacggcgacatcagccatacgccgcttcccgaaacctgggagaagcgc
aaggacgtgagccgcgacctctaccgctgcgccaagacgctgagtgtctga

DBGET integrated database retrieval system