KEGG   Deinococcus geothermalis: Dgeo_1637Help
Entry
Dgeo_1637         CDS       T00353                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dge  Deinococcus geothermalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dgeo_1637
   01230 Biosynthesis of amino acids
    Dgeo_1637
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_1637
   00030 Pentose phosphate pathway
    Dgeo_1637
   00051 Fructose and mannose metabolism
    Dgeo_1637
   00052 Galactose metabolism
    Dgeo_1637
  Energy metabolism
   00680 Methane metabolism
    Dgeo_1637
Enzymes [BR:dge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dgeo_1637
Protein phosphatases and associated proteins [BR:dge01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dgeo_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1741762..1742772)
Genome map
AA seq 336 aa AA seqDB search
MTDIPHLSTHANPAGIKRLAVLTSGGDAPGMNAAIRAVVRTATYQGLEVVGVRRGFSGLH
RGDLRLIGPRDVANTIQRGGTILLTARSHTWRTPEGRARGAQHLRDWGVDGLIVIGGDGS
FHGAHLLQQEHGIPVIGVPGTIDNDLYGTDHTIGYFTAVETALDAVDKLRDTGASHERIF
VIEVMGRHAGHIALEVAVAGGAEEVFIPEDPKPVDGIVQIVQDSVAKGKASSIIIVAEGY
PGGALGVAQAIEVGTGLETRVSILGHIQRGGSPVSSDRVLASRLGEAAVYALMDGYSDVM
VGRRNGDISHTPLPETWEKRKDVSRDLYRCAKTLSV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacattccccacctgtccacccatgccaaccccgccggaatcaagcgcctggcc
gtcctgacaagtggtggcgacgcgccggggatgaacgccgccattcgcgccgtcgtccgc
actgccacctatcagggcctggaggtggtgggtgtgcgccggggcttttccggcctgcac
cgcggtgacctgcgcctgatcgggccaagagatgtggcgaacaccatccagcgcggcggc
accatcctgctcaccgcccgctcgcacacctggcgcacacccgagggccgcgctcgcggc
gcgcagcatctgcgcgactggggcgtggacggcctgatcgtgatcggcggtgacggcagc
tttcacggcgcgcacctcctccagcaggaacacggcatcccggtgatcggagttccgggc
accatcgacaatgacctctacggcactgaccacaccatcgggtacttcacggcggttgag
acagccctggacgccgtggacaaactgcgcgacaccggcgccagccacgagcgcatcttt
gtgatcgaggtgatgggccgccatgccggacacatcgcgttggaggttgcggtcgcgggc
ggcgccgaggaagtctttatccccgaagaccccaagccggtggacggcatcgtgcagatc
gtgcaggacagtgtggcaaagggcaaggccagttcgatcatcatcgtcgccgaggggtac
ccgggtggggcgctgggcgtcgcgcaggccatcgaggtgggcaccgggctggaaacgcgg
gtcagcatcctgggccacatccaacgtggcggctcaccggtgagcagtgaccgcgtcctg
gcaagccgtctgggagaagccgccgtctacgctctgatggatggatacagcgatgtgatg
gtgggccgccgcaacggcgacatcagccatacgccgcttcccgaaacctgggagaagcgc
aaggacgtgagccgcgacctctaccgctgcgccaagacgctgagtgtctga

DBGET integrated database retrieval system