KEGG   Deinococcus geothermalis: Dgeo_1976Help
Entry
Dgeo_1976         CDS       T00353                                 

Definition
6-phosphogluconolactonase
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
dge  Deinococcus geothermalis
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dgeo_1976
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dgeo_1976
Enzymes [BR:dge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Dgeo_1976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2078153..2078830
Genome map
AA seq 225 aa AA seqDB search
MKLRVFPTPEATAQAAAEAFAQAAREAVAARGAFRVALSGGSTPKLMYRALRKLPDVPWP
AVHVYFSDERSVGPDSPDSNYRLAHDELLTHVPIPAGQIHRMEGERRPLEEAARAYAALL
PERLDVVLLGMGEDGHTASLFPGTQALEATGRVAANWVPKLKTGRLTFTFPEINAASERW
LLVTGSGKAEVLRAVQAGEGDYPVARVREPVWFLDAAAAAQLKQP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccgcgtctttcccacgcccgaagccacggcgcaggcagccgcggaagccttt
gcgcaggcagcgcgggaagcggtggcggcacgcggggcctttcgggtggcgctgtcgggc
ggcagcacaccgaaactgatgtaccgtgcgctccgcaagctgccggacgtaccctggccc
gccgtccacgtttacttcagtgacgagcgcagtgtggggccagacagccccgacagcaat
taccggctcgcgcacgacgaactgctcacacacgtcccgattcccgcaggccagatccac
cggatggagggcgagcgccgcccgctggaggaagccgcgcgggcctatgccgctctgctc
cccgaacggctcgacgtggtgctgctgggcatgggcgaggacggccataccgccagcctg
tttcccggcacccaggcgctggaggcaacaggccgggtggccgccaactgggtaccgaaa
ctgaagaccggacggctcaccttcacctttcccgagatcaacgcggcgagcgagcgctgg
ctgctggtcaccgggtcgggcaaggccgaggtgctgcgtgcggtgcaggccggcgagggg
gactatccggtggcgcgggtgcgggagccggtgtggttcctggacgcagcggcggcagca
caactgaagcagccctag

DBGET integrated database retrieval system