KEGG   Deinococcus geothermalis: Dgeo_1994Help
Entry
Dgeo_1994         CDS       T00353                                 

Definition
peptidase M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dge  Deinococcus geothermalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dge00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2096115..2097179
Genome map
AA seq 354 aa AA seqDB search
MTAQPNPIINQEFLFALLRAAAPSGYERRAADVWKKEAATFARVSEDHYGNVYAELGPED
APALALLGHLDEIGLMVSHVGDEGFLSVLAVGGWDPQVLVGQRVRLLAPDGDILGVVGKK
AIHVMEPEERKNASRIEDLWIDVGLSKEEAQARIPVGTYGVIEQGPLMVGDKIVSRALDN
RVGAFVVLEALRLLQGTELKHRVVAVGTSQEEIGSYGAQVGSHRLQPVAGVAVDVTHETG
QPGVSEKKYGVVPFGSGANLAVGPMTSPVILRQMIAAAQASGIPYTLSANPRLTHTDADT
MILSRSGVPSAVVSIPNRYMHSPNEMVDARDVKACIDLIAAWVRELEVGADFTR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgacggctcaacccaacccaatcatcaatcaggagttcctgttcgccctgctgcgcgca
gcggcccccagcggctatgagcgccgcgccgccgacgtgtggaaaaaggaggcggccacc
tttgcccgcgtcagcgaggaccactacggcaacgtgtacgccgaactgggcccagaggac
gcccccgccctcgcgctgctgggccacctcgatgagatcggcttgatggtcagccacgtg
ggggacgagggatttctgagcgtgctggcggtcggcggctgggacccgcaggtgctggtg
ggacagcgcgttcggctgctcgctccagacggtgacatcttgggtgtggttggcaagaag
gccattcacgtgatggaacccgaggagcgcaaaaacgccagtcgaatcgaggatctctgg
atcgatgtgggcctgagcaaggaagaggcgcaggcccgtatcccggttggcacctacggc
gtgatcgagcagggaccgctgatggtcggggataaaatcgtcagtcgcgccctcgataac
cgcgtcggggcctttgtggtgctggaggcattgcggctcctgcaaggcacggaactcaag
caccgcgtcgtcgcggtgggcaccagccaggaggagatcggcagctacggcgcgcaggtg
ggcagccaccgccttcagccggtcgcgggggtcgccgtggatgtgacccacgagacgggg
cagccgggtgtcagcgagaagaagtacggcgtcgtgccctttggctccggcgcaaacctg
gcggtcggcccgatgaccagcccggtcatcctgcgccagatgatcgccgccgcgcaggca
agcggcatcccctacaccctcagcgccaacccgcgcctcacccacaccgacgcggacacc
atgatcctgtcgcgctcgggggtacccagcgcggtggtcagcatccccaaccgctacatg
cactcacccaacgagatggtggacgcccgcgacgtgaaagcctgcatcgacctgatcgcg
gcgtgggtccgggagctggaggtgggggcggatttcacgcgctga

DBGET integrated database retrieval system