KEGG   Deinococcus geothermalis: Dgeo_1994Help
Entry
Dgeo_1994         CDS       T00353                                 

Definition
(GenBank) peptidase M42
Organism
dge  Deinococcus geothermalis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2096115..2097179
Genome map
AA seq 354 aa AA seqDB search
MTAQPNPIINQEFLFALLRAAAPSGYERRAADVWKKEAATFARVSEDHYGNVYAELGPED
APALALLGHLDEIGLMVSHVGDEGFLSVLAVGGWDPQVLVGQRVRLLAPDGDILGVVGKK
AIHVMEPEERKNASRIEDLWIDVGLSKEEAQARIPVGTYGVIEQGPLMVGDKIVSRALDN
RVGAFVVLEALRLLQGTELKHRVVAVGTSQEEIGSYGAQVGSHRLQPVAGVAVDVTHETG
QPGVSEKKYGVVPFGSGANLAVGPMTSPVILRQMIAAAQASGIPYTLSANPRLTHTDADT
MILSRSGVPSAVVSIPNRYMHSPNEMVDARDVKACIDLIAAWVRELEVGADFTR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgacggctcaacccaacccaatcatcaatcaggagttcctgttcgccctgctgcgcgca
gcggcccccagcggctatgagcgccgcgccgccgacgtgtggaaaaaggaggcggccacc
tttgcccgcgtcagcgaggaccactacggcaacgtgtacgccgaactgggcccagaggac
gcccccgccctcgcgctgctgggccacctcgatgagatcggcttgatggtcagccacgtg
ggggacgagggatttctgagcgtgctggcggtcggcggctgggacccgcaggtgctggtg
ggacagcgcgttcggctgctcgctccagacggtgacatcttgggtgtggttggcaagaag
gccattcacgtgatggaacccgaggagcgcaaaaacgccagtcgaatcgaggatctctgg
atcgatgtgggcctgagcaaggaagaggcgcaggcccgtatcccggttggcacctacggc
gtgatcgagcagggaccgctgatggtcggggataaaatcgtcagtcgcgccctcgataac
cgcgtcggggcctttgtggtgctggaggcattgcggctcctgcaaggcacggaactcaag
caccgcgtcgtcgcggtgggcaccagccaggaggagatcggcagctacggcgcgcaggtg
ggcagccaccgccttcagccggtcgcgggggtcgccgtggatgtgacccacgagacgggg
cagccgggtgtcagcgagaagaagtacggcgtcgtgccctttggctccggcgcaaacctg
gcggtcggcccgatgaccagcccggtcatcctgcgccagatgatcgccgccgcgcaggca
agcggcatcccctacaccctcagcgccaacccgcgcctcacccacaccgacgcggacacc
atgatcctgtcgcgctcgggggtacccagcgcggtggtcagcatccccaaccgctacatg
cactcacccaacgagatggtggacgcccgcgacgtgaaagcctgcatcgacctgatcgcg
gcgtgggtccgggagctggaggtgggggcggatttcacgcgctga

DBGET integrated database retrieval system