KEGG   Deinococcus geothermalis: Dgeo_2131Help
Entry
Dgeo_2131         CDS       T00353                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dge  Deinococcus geothermalis
Pathway
dge00860  Porphyrin and chlorophyll metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
Module
dge_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dgeo_2131
Enzymes [BR:dge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Dgeo_2131
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dgeo_2131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ABF46425
JGI: Dgeo2131
UniProt: Q1IWF9
Position
complement(2242346..2243869)
Genome map
AA seq 507 aa AA seqDB search
MTAAATSSSSRAFVSLIGAGPGDPGLLTLRGAEALRQADVVLFDYLANPDLLRFCPQAET
IYVGKKGFSEYISQEQINALIVEKAREGGGKRVARLKGGDVFVFGRGGEEAEACVQAGIP
FEIVPGVTSAIAAPAYAGIPVTHREAARSFAVLTGNTQEGGARYETLAGVDTLVLLMGVR
NLDQISADLIAAGRDPQTPAATVQWGTTPQQRVASGTLATIAQRVREAGLEAPAVTVVGE
VARLRETLRWFDVAPAGPLAGRTVAVTRTREGASALSELLRARGASVLEVPLIRFAATEN
AAALQTRLRDLSGVTWLLLTSNQAVTALFAHLEHLGLDARHLAGVKVAAVGPSTARSLAE
QGLRADFVPSTPGARYLGVQLPARPGEVALHLTSQVAEAELQQTLEARGIRYERAELYRT
EPARLSTPELERLRGADVVTLASGSAARHLAALAGTDFTVAAMGPQTADAARAAGFTRVT
VAREASLEALADAAAQAIREEAEASGS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgccgcaacttcttcttcctcccgcgcctttgtctcgctgatcggggcgggg
ccgggtgatccgggcctgctgaccctgcggggagccgaggcgcttcggcaggcggacgtg
gtgttgttcgactacctggcgaatcccgacctgctgcgcttttgcccccaggccgagacg
atctatgtgggcaagaagggcttttcggagtacatcagccaggaacagatcaacgcgctg
atcgtagaaaaggcgcgggaggggggcggaaagcgggtcgcgcggctcaagggcggggac
gtgttcgtgtttgggcgcggcggcgaggaggccgaggcgtgcgtgcaggctgggattccc
ttcgagattgtgccgggggtgaccagcgccatcgctgcccctgcctacgccggaattccg
gtgacccaccgcgaagccgcacggagtttcgccgtgctgaccggcaacacccaggaaggg
ggtgcccgttacgagacgctcgcgggggtcgataccctggtgctgctcatgggcgtgcgg
aatctcgatcagatcagcgcggatctgatcgccgcgggccgcgatccgcagacgcccgcc
gcaacggtgcagtggggcaccacaccgcagcagcgcgtggcgagcggcaccctggctacc
atcgcccagcgggtgcgcgaggccggtctggaagcgcccgccgtgacggtggtgggcgag
gtggcccgcctgcgggagacgctgcgctggtttgatgtggcgcccgccggtccgctcgcc
ggtcgaacggtcgccgtgacccgcacgcgggagggcgcgagtgctctctcggaactgctg
cgtgcccgcggggcgagcgtgctcgaagtgccgctgattcgcttcgccgcgacggagaac
gcggcggccctgcagactcgcctgcgtgacctgagcggcgtgacctggctcctcctgacc
agcaaccaggcagtcacggcgctgtttgcgcatctggagcacctgggtctggacgcgcgg
cacctcgcgggggtcaaggtggcggcggtcggccccagcacggctcgctcgctcgcggag
caaggcctgcgcgccgactttgtgcccagcacgcccggtgcccggtacttgggtgtacag
ctgcccgcgcggcccggcgaagtggctctgcacctcaccagtcaggttgcggaggcggag
ctgcaacagaccctagaagcacgcggcatccgctacgaacgagccgaactctaccgcact
gaaccggcgcggctgagcacgccggagctggaacgcctgcgtggggccgatgtggtgact
ctcgcttcgggcagcgcggcgcggcatctcgccgccctggcaggcaccgacttcacggtg
gcggcgatggggccgcagacggccgacgcggcacgcgcggctggattcacgcgggtgacc
gttgcgcgggaggcgagtctggaagctctggccgacgcggctgcgcaggccatccgggag
gaggcagaggcgagcgggagctga

DBGET integrated database retrieval system