KEGG   Deinococcus geothermalis: Dgeo_2158Help
Entry
Dgeo_2158         CDS       T00353                                 

Definition
phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase
Orthology
K01814  
phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
dge  Deinococcus geothermalis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dge01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:dge00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2274277..2275008)
Genome map
AA seq 243 aa AA seqDB search
MTPVSSRLQPLIIPCVDIQSGRAVRLYEGDPDRETVYFESPLEAARHWAALGAGLVHLVD
LDAATGRGENRAVITQITAELGVPVEVGGGIRDRAAAEALLDAGVGRVVIGTAAVKNPAL
VRELIAAHGPSRVVVSLDARGLDVAIHGWAEGSGVSVAELAPLLAEAGLETLIFTDVTRD
GTLRGLDRDLMRQVRQLWSNTLIVGGGVATLDDVRLLAEEGIQGAIVGRAIYEGTLVYPV
TGL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgtctcttcccgccttcagcctctgatcattccctgcgtggacatccagtcg
ggccgcgcggtgcgcctctatgagggtgaccccgaccgcgagacggtctacttcgagtcg
cctctggaggcggcccgccactgggctgccttgggtgcggggctggtgcatctggtggac
ctggacgccgccaccggacgcggtgagaaccgcgcagtcatcacgcagatcaccgccgaa
ctgggcgtaccggtcgaggtggggggcggcattcgcgaccgcgccgctgccgaagccctg
ctggacgccggagtgggacgggtggtgatcggcaccgccgctgtgaagaacccggcactc
gtgcgcgagctgattgccgcgcacggccccagtcgggttgtcgtgagcctggacgcacgc
ggcctggacgtcgctatccacgggtgggccgaaggcagcggcgtcagcgttgcggaactc
gcgccgctgttggcagaggcgggccttgaaacgctgatctttacagacgtgacccgtgac
ggcaccctccggggtctggaccgtgacctgatgcggcaggtccgccagctctggtcgaac
accctgattgtcggcggcggcgttgccacgctggacgatgtgcgcttgttggccgaggaa
ggtattcagggcgccatcgtgggccgggcgatctacgaggggacgctggtctatccagtg
acgggtctctga

DBGET integrated database retrieval system