KEGG   Deinococcus geothermalis: Dgeo_2162Help
Entry
Dgeo_2162         CDS       T00353                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dge  Deinococcus geothermalis
Pathway
dge00071  Fatty acid degradation
dge00280  Valine, leucine and isoleucine degradation
dge00281  Geraniol degradation
dge00310  Lysine degradation
dge00360  Phenylalanine metabolism
dge00362  Benzoate degradation
dge00380  Tryptophan metabolism
dge00410  beta-Alanine metabolism
dge00627  Aminobenzoate degradation
dge00640  Propanoate metabolism
dge00650  Butanoate metabolism
dge00903  Limonene and pinene degradation
dge00930  Caprolactam degradation
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01212  Fatty acid metabolism
Module
dge_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dgeo_2162
   00650 Butanoate metabolism
    Dgeo_2162
  Lipid metabolism
   00071 Fatty acid degradation
    Dgeo_2162
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dgeo_2162
   00310 Lysine degradation
    Dgeo_2162
   00360 Phenylalanine metabolism
    Dgeo_2162
   00380 Tryptophan metabolism
    Dgeo_2162
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dgeo_2162
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dgeo_2162
   00281 Geraniol degradation
    Dgeo_2162
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dgeo_2162
   00627 Aminobenzoate degradation
    Dgeo_2162
   00930 Caprolactam degradation
    Dgeo_2162
Enzymes [BR:dge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dgeo_2162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABF46456
JGI: Dgeo2162
UniProt: Q1IWC8
Position
complement(2278701..2279522)
Genome map
AA seq 273 aa AA seqDB search
MHPEELTAPGAYPGLHLSLTDDGILEIVIRSGKTLGSVNAEAHRALTSIWRDIDTAKGVR
CVLIRGEGRAFSSGGDFSLIEEMAGDFTALTRVWKEARDLVYNVINCGKPIVSAIHGPCV
GAGLAVALLADVSVAARNARILDGHVRLGVAAGDHAAIIWPLLCGLNKAKYHLLTGEPVS
GEEAERIGLVSLCVPDDELLPRAWQVARRLASGSPTAVRWTKYALNNWLRAMGPTFDASL
ALEFLGFTGPDVREGLASLREKREPRFQEDAPL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccgaagagctcaccgcgccgggcgcctaccctggcctgcacctgtccctgacc
gacgacggcatcctcgagattgtcatccgcagcgggaagacgttgggcagcgtgaatgcc
gaggcgcaccgagcgctcacgtccatctggcgcgacatcgacaccgccaaaggcgtccgc
tgcgtgctgattcgtggtgaggggcgggcgttctcgtcgggcggcgacttcagcctgatt
gaagagatggcaggagacttcacggcgctgacccgcgtgtggaaggaagcccgcgacctc
gtctacaacgtcatcaactgcggtaagcccatcgtgagcgcgattcatggcccctgcgtc
ggcgcgggcctggctgtcgcgctgctggccgacgtgagtgtggcggcgaggaacgcccgg
attctggatggacatgttcggcttggtgtggcggcgggcgaccacgcggcgatcatctgg
ccgctgctgtgtggcctcaacaaggccaagtaccacctcctgaccggcgaacccgtctcc
ggcgaggaggccgagcgcatcggcctggtcagcctctgcgtgcccgatgacgagctgctc
ccgcgtgcctggcaggtggcccgccgcctggcgagtggcagtcctacggccgtccgctgg
accaaatacgccctgaacaactggctgcgggcgatggggccgaccttcgatgccagcctc
gccctggaattcctgggctttacggggccggacgtgcgcgagggcctcgccagcctgcgc
gagaagcgcgagccgcggtttcaggaggacgcgccgctttga

DBGET integrated database retrieval system