KEGG   Deinococcus geothermalis: Dgeo_2180Help
Entry
Dgeo_2180         CDS       T00353                                 

Definition
(GenBank) Pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
dge  Deinococcus geothermalis
Pathway
dge00240  Pyrimidine metabolism
dge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dgeo_2180
Enzymes [BR:dge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Dgeo_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C Biotin_lipoyl DUF2254
Motif
Other DBs
NCBI-ProteinID: ABF46474
JGI: Dgeo2180
UniProt: Q1IWB0
Position
complement(2298605..2299912)
Genome map
AA seq 435 aa AA seqDB search
MAPLPQIPDLIRKKRDGFEHSRAELEALVLGYTRGEVPDYQISAWLMAVYLKGMTLQETA
DLTQVMAESGEQLDLSGLPRTVDKHSTGGVGDKTSLILTPMLAALGLTVAKMSGRGLAHT
GGTIDKLESFPGWTPELSEAQFLTQAHEIGLALVGQSKDLAPADGKLYALRDVTATVDCL
PLIASSIMSKKLASGAHTVVLDVKVGAGAFMRTLEDGRALARAMVDIGTRAGRQVRAVLT
DMDTPLGHMAGNSLEVQEALATLRGEGPADLTELCVALAVEALAAYGEEPAQAEARAQAT
LRDGSALAKFRAFIAAQGGDAALVDHPERLDLAPGRAEVTAPSSGYVERVDALAVGRAVL
ALGGGRERKGEAIDHGVGVELLKKPGEAVQAGEAVLRLYHREGRGLEAARGLLEAGLRVG
DTPPAPEPLILDRVN
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctccattgcctcagattcccgacctgattcgcaagaaacgtgacggcttcgagcat
tcccgtgccgagctcgaagccttggtgctgggttacacccgcggtgaagtgcccgactac
cagatcagcgcctggctgatggccgtgtatctgaagggcatgacgctgcaggaaacggcc
gacctgacccaggtgatggcggaaagcggcgagcagcttgacctctccgggctgccgcgc
acggtggataagcactccaccggtggtgtgggcgacaaaaccagcctgatcctcacgccg
atgctggcggcccttggcctcacggtcgccaagatgagcgggcgcggcctggcacacacc
ggcggcaccatcgataagctcgaaagcttccccggttggactcctgagctgtccgaggcg
cagtttctgacccaggcccacgagatcggcctcgcgctggtgggccaatcgaaggatctg
gcccccgccgacggcaagctgtacgcgctgcgcgatgtgacagccacggtagactgcctg
cccctgatcgcctcctcgatcatgagcaagaaactcgcgtcgggtgcccacaccgtcgtg
ctcgacgtgaaggtgggggcaggggccttcatgcggaccttggaggacggtcgtgccctg
gcccgcgcgatggtggatatcggtacgcgggctgggcgccaggttcgggctgtgctgacc
gatatggacacgccgctgggccacatggccggaaacagcctggaagtgcaagaagccctc
gccaccctgcgtggggaaggccccgccgatctgaccgagctgtgtgtggcgctggcggtg
gaggcgctggcggcctacggcgaggagccggcgcaagccgaggcccgcgcccaggcgacc
ctgagggacggctcggctctggcaaaattccgcgccttcattgcggcgcaggggggagac
gcggcgctggtggaccatcccgaacggctggacctggcccccggacgcgccgaggtgacg
gccccgtcctccgggtacgtggaacgggtggacgccctggcggtgggtcgggctgtcctc
gcgctgggcggtgggcgcgagcgcaagggcgaggcgattgaccacggtgtcggtgtggag
ctgctcaagaaacctggcgaggcggtgcaggcgggtgaggcggtgctccgtctctaccac
agagagggtcggggcttggaggccgcacggggactgctggaagcgggcctgcgggtgggc
gacacgccgcccgcgcccgagccgctgattctggaccgcgtgaactga

DBGET integrated database retrieval system