KEGG   Deinococcus geothermalis: Dgeo_2180Help
Entry
Dgeo_2180         CDS       T00353                                 

Definition
pyrimidine-nucleoside phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
dge  Deinococcus geothermalis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dge00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2298605..2299912)
Genome map
AA seq 435 aa AA seqDB search
MAPLPQIPDLIRKKRDGFEHSRAELEALVLGYTRGEVPDYQISAWLMAVYLKGMTLQETA
DLTQVMAESGEQLDLSGLPRTVDKHSTGGVGDKTSLILTPMLAALGLTVAKMSGRGLAHT
GGTIDKLESFPGWTPELSEAQFLTQAHEIGLALVGQSKDLAPADGKLYALRDVTATVDCL
PLIASSIMSKKLASGAHTVVLDVKVGAGAFMRTLEDGRALARAMVDIGTRAGRQVRAVLT
DMDTPLGHMAGNSLEVQEALATLRGEGPADLTELCVALAVEALAAYGEEPAQAEARAQAT
LRDGSALAKFRAFIAAQGGDAALVDHPERLDLAPGRAEVTAPSSGYVERVDALAVGRAVL
ALGGGRERKGEAIDHGVGVELLKKPGEAVQAGEAVLRLYHREGRGLEAARGLLEAGLRVG
DTPPAPEPLILDRVN
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctccattgcctcagattcccgacctgattcgcaagaaacgtgacggcttcgagcat
tcccgtgccgagctcgaagccttggtgctgggttacacccgcggtgaagtgcccgactac
cagatcagcgcctggctgatggccgtgtatctgaagggcatgacgctgcaggaaacggcc
gacctgacccaggtgatggcggaaagcggcgagcagcttgacctctccgggctgccgcgc
acggtggataagcactccaccggtggtgtgggcgacaaaaccagcctgatcctcacgccg
atgctggcggcccttggcctcacggtcgccaagatgagcgggcgcggcctggcacacacc
ggcggcaccatcgataagctcgaaagcttccccggttggactcctgagctgtccgaggcg
cagtttctgacccaggcccacgagatcggcctcgcgctggtgggccaatcgaaggatctg
gcccccgccgacggcaagctgtacgcgctgcgcgatgtgacagccacggtagactgcctg
cccctgatcgcctcctcgatcatgagcaagaaactcgcgtcgggtgcccacaccgtcgtg
ctcgacgtgaaggtgggggcaggggccttcatgcggaccttggaggacggtcgtgccctg
gcccgcgcgatggtggatatcggtacgcgggctgggcgccaggttcgggctgtgctgacc
gatatggacacgccgctgggccacatggccggaaacagcctggaagtgcaagaagccctc
gccaccctgcgtggggaaggccccgccgatctgaccgagctgtgtgtggcgctggcggtg
gaggcgctggcggcctacggcgaggagccggcgcaagccgaggcccgcgcccaggcgacc
ctgagggacggctcggctctggcaaaattccgcgccttcattgcggcgcaggggggagac
gcggcgctggtggaccatcccgaacggctggacctggcccccggacgcgccgaggtgacg
gccccgtcctccgggtacgtggaacgggtggacgccctggcggtgggtcgggctgtcctc
gcgctgggcggtgggcgcgagcgcaagggcgaggcgattgaccacggtgtcggtgtggag
ctgctcaagaaacctggcgaggcggtgcaggcgggtgaggcggtgctccgtctctaccac
agagagggtcggggcttggaggccgcacggggactgctggaagcgggcctgcgggtgggc
gacacgccgcccgcgcccgagccgctgattctggaccgcgtgaactga

DBGET integrated database retrieval system