KEGG   Deinococcus geothermalis: Dgeo_2228Help
Entry
Dgeo_2228         CDS       T00353                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dge  Deinococcus geothermalis
Pathway
dge00010  Glycolysis / Gluconeogenesis
dge00260  Glycine, serine and threonine metabolism
dge00680  Methane metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
dge01230  Biosynthesis of amino acids
Module
dge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dge_M00002  Glycolysis, core module involving three-carbon compounds
dge_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgeo_2228
  Energy metabolism
   00680 Methane metabolism
    Dgeo_2228
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dgeo_2228
Enzymes [BR:dge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dgeo_2228
Membrane trafficking [BR:dge04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dgeo_2228
Exosome [BR:dge04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dgeo_2228
  Exosomal proteins of melanoma cells
   Dgeo_2228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABF46522
JGI: Dgeo2228
UniProt: Q1IW62
Position
complement(2348373..2349056)
Genome map
AA seq 227 aa AA seqDB search
MVVGLRPGPWPSRPEMIAQTLHLTLLRHGRSRADDEGVHEGRYDSPLTEVGRVQAQALAE
YWRTHPPGFDLAFCSTLARAHETARIITDMLGVPLRPDDLWREWDNGPLAGLPRDEALHR
FPLPAFRHDLDPFTIDGGESQAAIRARALLALERVWQTGVTNVLLVSHGGFLNSVLRELT
GAGRGWFAFGDTGFATVELSRTSHTAVLTAVNLTPHLSIPVAAADTD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtggtggttggccttcgccctggtccatggccatcaagacctgagatgatcgctcagacg
ctccaccttaccctgctccgccacggccgcagccgcgccgatgacgagggggtgcatgag
ggccgttacgactccccactgactgaggtgggccgcgttcaggcccaggcgcttgccgag
tactggcggacacacccgccgggcttcgatttggccttctgttccacgctggcccgcgcg
cacgagacagcccgcatcatcaccgacatgctgggagtgcccctgcgccccgatgacctg
tggcgggagtgggacaacggtcctctggcgggtctgccgcgtgacgaggcgctgcaccgt
tttcccctccccgcctttcggcacgatcttgatcccttcactattgatgggggtgagagt
caggcggcgattcgggcgcgggcactcctggccctggagcgtgtgtggcagaccggggtc
acgaacgtgttgttggtatcgcacggtggctttctcaacagtgtgctgcgtgaactgacc
ggagcagggcggggttggttcgcctttggcgacacgggatttgccactgtggaactctcc
cgcaccagtcataccgccgtactgactgccgtgaacctgaccccgcacctctctattcct
gtcgcagcagcggatacggattga

DBGET integrated database retrieval system