KEGG   Deinococcus geothermalis: Dgeo_2252Help
Entry
Dgeo_2252         CDS       T00353                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dge  Deinococcus geothermalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dgeo_2252
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dgeo_2252
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dgeo_2252
Enzymes [BR:dge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dgeo_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2378110..2379147
Genome map
AA seq 345 aa AA seqDB search
MPGLIERYREYLPVTARTPALSLHEGNTPLVPAPKLSARLGVDLYLKYEGLNPTGSFKDR
GMVMAVAKAVEDGADTIICASTGNTSASAAAYAARSGLKCIVLIPDGNIALGKLAQAMAY
GARIIAINGNFDAALKLVRQISAEHPIALVNSVNPYRLEGQKTAAFEIVDVLGRAPDILA
LPVGNAGNISAYWKGFREYQDAGKNSNLPRMWGFQAEGAAPLVRGAIVDEPQTLATAIRI
GNPASADLARAAVQESGGLFDLASDDEIMHAYNLVAQEGIFCEPASATPVAGLLKLHAAG
RLTPGQTVVAVLTGNGLKDPDAALRAVEAPRVVEASIERVLESIR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcccggattgattgaacgctaccgcgagtacctgcctgtcaccgccagaacgccggcc
ctgagcctgcacgaggggaatacgccgctggttcccgcgcccaagctgagtgcgcggctg
ggggtggacctgtacctgaagtacgaggggctcaacccgaccggcagcttcaaggaccgc
ggcatggtgatggcggtcgccaaggcagtcgaagacggggcggacaccatcatctgcgcg
agcaccggcaacaccagcgcctctgcggctgcctacgccgcacgttcaggcctgaagtgc
atcgtgctgattcccgacggcaacattgctctgggcaagctggcgcaggcgatggcctac
ggcgcgcgcatcatcgcgatcaacggcaactttgacgccgccctcaaactggtgcgtcag
atcagcgccgaacatcccatcgcgctggtgaactcggtgaatccctaccgcctggaagga
caaaaaacggcagccttcgaaatcgtagacgtgctgggccgggcacccgatatcctcgct
cttccggtgggcaacgccgggaacatcagtgcctactggaagggcttccgcgagtaccag
gacgccggaaaaaacagcaacctgcccaggatgtggggctttcaggcggagggggctgcg
ccgttggtgcggggcgccattgtggatgagccgcagacgctcgcgaccgccatccgcatc
ggcaacccggccagcgccgacctcgcccgcgcggcggtgcaggagagtggcggcctcttc
gacctggccagcgatgacgagattatgcacgcctacaatctcgtggcacaggagggcatc
ttctgcgaaccggccagcgccaccccggttgcgggcctgctgaagctgcacgccgctgga
cggctgacgccgggacagacagtcgtggcggtgctcacggggaacggcctcaaggatccc
gacgccgcgttgcgcgccgtggaagcccccagggttgtggaggcgagcatagagcgggta
ctggaaagcatcaggtga

DBGET integrated database retrieval system