KEGG   Deinococcus geothermalis: Dgeo_2284Help
Entry
Dgeo_2284         CDS       T00353                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dge  Deinococcus geothermalis
Pathway
dge00230  Purine metabolism
dge01100  Metabolic pathways
Module
dge_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dgeo_2284
Enzymes [BR:dge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dgeo_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 RRF
Motif
Other DBs
NCBI-ProteinID: ABF46578
JGI: Dgeo2284
UniProt: Q1IW06
Position
complement(2406815..2407543)
Genome map
AA seq 242 aa AA seqDB search
MLPSMMVARPDPQTTSSSSHRGLLIVMTGASGVGKGTLRERWLAGQDVFYSTSWTTREAR
PGERDGVDYVFVTPEVFLEKVRQNGFLEHAQFVGNHYGTPTEPIEAALARGQDVVLEIEV
EGAMQVKERMGEEAVLVFIMPPSLTELRRRLTGRATETPERIEKRLQRARDEIMAAHAFR
YVIVNDDLDRAVRELQAVQRAEHARQRPETEWTAEDRAAVQLAETVRSTVLTTEDLQRIV
NS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctagcatgatggttgctcggcctgacccacaaaccacttcgtcctcttctcac
cgcggcctcctgatcgtgatgaccggcgcttcgggcgtcggcaagggcacgctgcgcgag
cgttggctggctggacaggacgtgttctattcaacctcatggacgactcgtgaggcgcgt
cccggtgaacgtgacggtgtggattacgtgttcgtgacccctgaggtgtttctggaaaag
gttcggcagaacggctttctggaacacgcccaatttgtggggaaccactacggcacgccc
actgaacccattgaggcggcactcgcacgtgggcaggacgtggtgctggagatcgaggtc
gagggggcgatgcaggtcaaggaacggatgggcgaggaggcggtgctggtgtttatcatg
ccgcccagtctgaccgagctgcgccgccgcctgaccgggcgcgccaccgagacgcccgag
cgtattgagaaacgcctgcagcgggcccgcgacgagatcatggcggcccacgcctttcgt
tacgtgattgtgaacgacgatctggaccgtgccgtccgtgaactgcaggccgtccaacgc
gccgagcatgcacggcagcgcccagaaaccgagtggacggcagaagaccgggcagcggtg
cagcttgccgaaacagtacggagcacggtcctgaccaccgaagatctacagcggattgtc
aacagttaa

DBGET integrated database retrieval system