KEGG   Deinococcus geothermalis: Dgeo_2611Help
Entry
Dgeo_2611         CDS       T00353                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dge  Deinococcus geothermalis
Pathway
dge00620  Pyruvate metabolism
dge00630  Glyoxylate and dicarboxylate metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01200  Carbon metabolism
Module
dge_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dgeo_2611
   00630 Glyoxylate and dicarboxylate metabolism
    Dgeo_2611
Enzymes [BR:dge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dgeo_2611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI SMP
Motif
Other DBs
NCBI-ProteinID: ABF44045
JGI: Dgeo2611
UniProt: Q1J389
Position
pDGEO01:441046..442428
Genome map
AA seq 460 aa AA seqDB search
MTLPGTDLSRALEARFSQRRRALLARPRDGWTPGFDPRTAAIRQADWQVAPPPAELRGRV
VEQLVEPSDAAAIQAALEAGPDALIFDFDDTFSPTPANVRAGHANLRTLPTAGGPLPMTR
PRPLYLEDGQGASASLQDLAAFVEAFGDRETLYVYLPKLEFPEEAEFWQDLLTETERLTG
RAPGSLRVCLQIETLPGAFYADELLYALRERAFGLNAGRWDYVFSAVKWLSQDRRFCLPE
RGKLNMDQPSMRAYEQHLARVCARRGAQAIGGTAALAPDPADPEPALAVVRADKAREAAQ
GFVAAWAGLPSLIPTVRAVFQSTPPAAPPAPKPEEEVASALLAFPRVVEVPLSAVREAIG
VATDYFRAWLAGQGVIVRQHRVEDTATAELARAQLWQWVRHRVPLETGEVLTPERFGALL
TEQADPQEPAARLLRALVLSETCPPFFPAAARTLDEVPLA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctacccggtaccgacctgtcccgcgccctggaggcccgcttctcgcagcgccgc
cgcgccctgctcgcccgcccccgggacggctggacacccggcttcgatccccgcaccgcg
gccattcgccaggccgactggcaggtggcgcccccgcccgctgaactgcgggggcgagtg
gtggaacaactggtggaacccagcgacgcggcggcgattcaagccgcgctggaggctggc
cccgacgcgctgatcttcgacttcgacgacaccttctcccccacccccgcgaatgtccgc
gcggggcacgccaacctgcgcacgctgcccacggcgggcggcccgctcccgatgacccgg
ccccggcccctctacctggaggacgggcagggggccagcgccagccttcaggacctggcc
gcctttgtggaggcgtttggagaccgggaaaccctgtacgtctacctccccaagctggaa
ttccccgaagaggccgagttctggcaggacctgctgaccgaaaccgagcggctcacgggg
cgcgcgccgggcagcctccgggtctgtcttcagatcgagacgctgcccggtgccttctat
gccgacgagctgttgtacgcgctgcgggaacgggcctttgggctgaacgcggggcgctgg
gattacgtgttcagcgcggtcaagtggctgagccaggatcgccgcttctgcctgccggaa
cgcggcaagctgaacatggatcagccctccatgcgcgcctacgagcagcacctggcccgc
gtgtgtgcccggcggggcgcgcaggccatcggcggaaccgctgcactggcgcccgatccc
gccgatcccgaacccgcgctggcggtggtccgcgccgacaaggctcgcgaggcggcgcaa
ggctttgtcgcggcttgggccgggttgccaagtctgattccgaccgtccgggctgtgttc
cagtccaccccacccgccgcgccgcctgcgccaaagccagaagaggaggtcgcctcggcg
ctgctggccttcccccgcgtggtcgaggtaccgctgtccgccgtgcgcgaggccatcggc
gtggcgacggactatttccgagcctggttggccggacagggcgtgatcgtgcggcagcat
cgggtagaggacaccgcgaccgccgaactcgcccgcgcgcaactgtggcaatgggtgaga
caccgcgtcccgctggaaaccggcgaggtgctgacgcccgaacgcttcggggcactgctg
acggaacaggccgacccccaggaacccgccgcccggttgctgcgcgcgctggtcctctcc
gagacctgcccgcccttctttcccgccgccgcccgcaccctcgacgaggttccgctcgca
tga

DBGET integrated database retrieval system