KEGG   Deinococcus geothermalis: Dgeo_2616Help
Entry
Dgeo_2616         CDS       T00353                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
dge  Deinococcus geothermalis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dgeo_2616
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dgeo_2616
   00630 Glyoxylate and dicarboxylate metabolism
    Dgeo_2616
Enzymes [BR:dge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dgeo_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pDGEO01:complement(434132..435700)
Genome map
AA seq 522 aa AA seqDB search
MTQALHLPAGMTITAPLQAAYAEILTPEALAFVAELHRRFDARRRELLAAREERQARLDA
GELPDFLPETADVRAGDWKIAPLPADLQDRRVEITGPVDRKMIINALNSGARMFMADFED
ASSPTWENMVEGQINLRDAVRGTISLDQGGKQYRLNDKVAMLLVRPRGLHLPEKHVSVDG
ETLSGSLFDFGLYAFHNMQERLRQGTGTYFYIPKLESHREARWWNEVFTFAEDTLGAPRG
TIRATVLIETILAAFEMDEILYELREHSAGLNSGRWDYIFSYIKKFRSRSDKILPDRAQV
TMAVPMMANYAKLAIQTAHRRGAPAIGGMSAFIPVKNDPEANARAFAQVRADKEREATNG
HDGTWVAHPGMVGLATEVFDRLMPTPNQIDSGKQADLQVTAADLLTPPDGTVTEAGVRTN
ISVGVQYLAAWLQGRGAVPIHNLMEDAATAEISRAQLWQWLHHRVPLEDGRPLTPELLDQ
FFAEELGKLGPDYAAAGRLFKDIATRSPLAEFLTLPAYRELA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggccctgcaccttcccgctggcatgaccatcaccgctccccttcaggcggcg
tacgctgagattctgacgccggaggcgctcgcctttgtggctgagctgcaccggcgcttt
gacgcccgccgccgtgaactgctcgccgcgcgcgaggagcggcaggcgcggctggacgcg
ggtgagctgcccgactttctgcccgagacggcggatgtgcgcgccggagactggaagatc
gcgcctctgcccgccgaccttcaggaccgccgcgtggagatcaccggcccggtggaccgc
aagatgatcatcaacgcgctcaacagcggcgcgcgcatgtttatggccgacttcgaggac
gccagcagccccacctgggagaatatggtggaaggccagatcaacctgcgcgacgcggtg
cgcggcaccatcagcctcgatcagggcggcaagcagtaccgcctgaatgacaaggtcgcc
atgctgcttgtccgcccgcgcggcctgcacctcccggagaagcacgtcagcgtggacggc
gagacgctgagcggttccctcttcgacttcggcctctacgccttccacaacatgcaggag
cgcctccggcagggcaccggcacctacttctatatccccaagctcgaaagccaccgcgaa
gcgcgctggtggaacgaggtcttcacctttgcggaagataccctcggcgcgccgcgcggc
accatccgcgccacggtcttgatcgagacgattctcgccgccttcgagatggacgagatc
ctctacgagctgcgcgagcattcggcggggctgaacagcggccgctgggactacatcttc
agctacatcaagaagtttcgcagccggagtgacaagattctccccgaccgtgcccaggtc
acaatggcggtcccgatgatggcgaactacgccaagctcgctatccagaccgcccaccgg
cgtggtgccccggccatcggcggcatgagcgcctttattcctgtgaagaacgaccccgag
gccaatgcgcgcgccttcgcgcaggtccgcgccgataaggaacgcgaggcgacaaacggc
cacgacggcacctgggtcgcgcaccccggcatggtggggctcgccaccgaggtcttcgac
cggctgatgcccacgccgaaccagatcgactccggcaagcaggcggacctgcaggtgaca
gcggcggacctgctcaccccgcccgacggcaccgtgaccgaggcgggggtgcggaccaac
atcagtgtcggcgttcaatacctcgctgcctggctccagggccgcggcgcggtaccgatc
cataacctgatggaagacgcggcgaccgccgagatcagccgcgcccagctctggcagtgg
ctccaccaccgcgtgcccctggaagatggtcgccccctcacgcccgagctgctcgaccag
ttcttcgcggaagagttgggcaagctcggccccgactacgccgcggctgggcggcttttc
aaggacattgccacccgttcgccgctcgccgaattcctgacgttgcccgcctaccgggaa
ctcgcttga

DBGET integrated database retrieval system