KEGG   Deinococcus geothermalis: Dgeo_2732Help
Entry
Dgeo_2732         CDS       T00353                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dge  Deinococcus geothermalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dgeo_2732
Enzymes [BR:dge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Dgeo_2732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pDGEO01:294561..295496
Genome map
AA seq 311 aa AA seqDB search
MVSIKQPNSTPPSHLPYGGIASFARAPTFEPGGNWQADVAVLGIPYDIALGFRPGARYAP
RALREASLRYVPPFTDLSGRTRLADVTFADAGDVVLPSLEPELARERITQTARQVRKRAR
LPVFLGGDHSVTYPLLRAFDDQPDLHVIQLDAHLDFTDERNGTRYSNSSPFRRAAEDLSN
LVHITTLGLRGLRHDPEALAAARTRGHTLVPMEEVEARLGEVVTALPPGSPVYLSVDADA
FDPAVLPGTSSPEPDGFSYALALRVIREVVRRHRLVGMDLVELAPNLDPSGRSALIGARL
VMETLCEAFDG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtggtctccatcaagcaaccgaactccacccccccctcgcaccttccctacggcggcatc
gcctccttcgcccgcgcgcccacctttgaaccgggcgggaactggcaggccgacgtggcc
gtgttgggcattccgtatgacatcgccctcggttttcggcccggggctcgctacgcgccg
cgtgcgctgcgggaggccagcttgcgttacgtgccgcccttcaccgacctgtcggggcga
acgcggctggcggacgtgaccttcgcggacgccggagacgtggtgctgcccagcctggaa
cccgaactcgcccgcgaacgcatcacgcagacggcacggcaggtgaggaaacgcgcccgg
cttcccgtcttcctgggcggcgaccacagcgtgacctatccgctgctgcgcgcctttgac
gaccagccggacctacacgtcatccagctcgacgcgcatctcgacttcaccgacgaacgg
aatggcacgcgctacagcaattccagtccctttcgacgggcggccgaagacctctccaat
ctcgttcacatcacgacgctggggctgcgcggcctgagacacgaccccgaggctctggcg
gcggcgcggacacgtgggcacaccttggtgccgatggaggaggtcgaagcgcggttgggc
gaggtggtgacggcccttccccccggcagcccggtctatctcagcgtggatgcagacgcc
ttcgatcccgccgtgttgcccggcaccagcagccccgagccggacggcttcagctacgcc
cttgccctgcgggtgatccgcgaggtggtgcggcggcatcgcctggtcgggatggacctc
gtcgaactcgcacccaacctcgaccccagcgggcgcagcgccctgatcggcgcgcggctg
gtgatggagacgctctgcgaggccttcgatggctga

DBGET integrated database retrieval system