KEGG   Deinococcus geothermalis: Dgeo_2828Help
Entry
Dgeo_2828         CDS       T00353                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
dge  Deinococcus geothermalis
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dge00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dge00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pDGEO01:197949..199481
Genome map
AA seq 510 aa AA seqDB search
MTSERSWTLPISPHELRVLVNGYQSWSEAELRALLDTPQRALFSWMIEQGQDPVFPPSGE
AGVWRSHTLIALIRPDGGGWVGCLQDARQTFAHWEARAVGGQVELSCTLEGPPAEVAFEE
TEDVITTVETLTARLGTVMQARTPPPLRVWCSWYSYYRDVTLAAMLDNARLARELALPFD
VFQLDDGFQADLGDWLEPSAWFGGHAKDLPAQLKELGFRAGLWLAPFLVGPRSRLRAQQP
EWLLRGADGEPLLAGHNWGGPYHVLDTTHPEVLAWLRDLAATVRGWGYTYLKLDFLYGAA
LPGVRYDPAVSRAAAYRQGVQALRDGAGEETFLLGCGAPLASSIGLVDAMRTGPDVTPFW
DDEARRVLLGDGAVPSTRSVLHTALSRWYQHAWYQPDPDVMIARRELSLLGEHERGALLG
LLDVIGGLRASSDPIRLLDEAGRALLRQSLQLSRPDRPRTLTTSYGGAVTHFTRGTFNLL
DVPAGGLAPHSYSAAQVGGLQPLLARHQQT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgagcggtcctggaccctgcccatctcccctcatgaactgcgggttctcgtg
aacggctaccagtcgtggagcgaggcggagctgcgggcgctgctggacacgccgcagcgc
gcgctgttttcgtggatgatcgagcaggggcaagatccggtctttccccccagcggggag
gcgggcgtatggcgttcgcacaccctgatcgccctgattcgcccggatgggggcggctgg
gtgggctgtcttcaagatgcccggcagacctttgctcactgggaggcgcgggcggtgggg
gggcaggtggagctgagctgcaccttggagggtcccccagcggaggtggcctttgaggag
accgaggacgtgatcacaaccgtcgaaaccctcacggcacgattgggaacggtgatgcag
gcccggaccccgccgcccctgcgggtgtggtgcagttggtacagctactaccgggacgtg
acgctcgccgcgatgctggacaatgcccggctcgcccgcgagttggcgctgcctttcgat
gtgtttcagctggacgacggctttcaggcagatttgggcgactggttggagcctagcgcc
tggttcgggggtcatgcgaaggaccttccggcgcagctcaaagaactcggcttccgggct
gggttgtggttggctccctttttggtgggtccgcgctcgcggctgcgggcgcagcagcca
gagtggctgctgcgcggtgcggacggggagccgctgctggcagggcacaactggggcggt
ccctaccacgtgctggacaccacccaccccgaggtgctggcgtggctgcgtgacctggcg
gccactgtgcgggggtggggctacacgtatctgaagctggactttctgtacggggctgcg
ctgcccggggtgcggtatgacccagcggtgagccgggctgcggcctaccggcagggtgtg
caggcgctgcgggatggggcgggcgaggagaccttcctgctggggtgtggggcgcccctt
gcgagcagcatcgggctggtggacgcgatgcggaccgggccggacgtgacgcccttttgg
gacgacgaggcgcggcgggtgctgctgggggacggggcggtgcccagcacgcgtagcgtg
ctgcacacggccctgtcgcgctggtaccagcatgcctggtaccagcctgacccggatgtg
atgattgcccggcgggaactgagtctgctgggggaacacgagcgcggcgccctgcttggc
ctgctcgacgtgattggtggcctgcgggcgagcagcgatcccatccggctgctggacgag
gcgggacgggcgctgctgcggcagagcctgcagctcagccgcccggatcggccccggacg
ctgacgacgagttacggcggagcggtgacccacttcacgcggggcacctttaacctgctg
gatgtgcctgcgggtggcctggcgccgcacagttacagcgcggcccaggttgggggtctc
cagccccttctcgcccgccaccagcagacctag

DBGET integrated database retrieval system