KEGG   Deinococcus geothermalis: Dgeo_2828Help
Entry
Dgeo_2828         CDS       T00353                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
dge  Deinococcus geothermalis
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dge00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dgeo_2828
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dgeo_2828
   00600 Sphingolipid metabolism
    Dgeo_2828
Enzymes [BR:dge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dgeo_2828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pDGEO01:197949..199481
Genome map
AA seq 510 aa AA seqDB search
MTSERSWTLPISPHELRVLVNGYQSWSEAELRALLDTPQRALFSWMIEQGQDPVFPPSGE
AGVWRSHTLIALIRPDGGGWVGCLQDARQTFAHWEARAVGGQVELSCTLEGPPAEVAFEE
TEDVITTVETLTARLGTVMQARTPPPLRVWCSWYSYYRDVTLAAMLDNARLARELALPFD
VFQLDDGFQADLGDWLEPSAWFGGHAKDLPAQLKELGFRAGLWLAPFLVGPRSRLRAQQP
EWLLRGADGEPLLAGHNWGGPYHVLDTTHPEVLAWLRDLAATVRGWGYTYLKLDFLYGAA
LPGVRYDPAVSRAAAYRQGVQALRDGAGEETFLLGCGAPLASSIGLVDAMRTGPDVTPFW
DDEARRVLLGDGAVPSTRSVLHTALSRWYQHAWYQPDPDVMIARRELSLLGEHERGALLG
LLDVIGGLRASSDPIRLLDEAGRALLRQSLQLSRPDRPRTLTTSYGGAVTHFTRGTFNLL
DVPAGGLAPHSYSAAQVGGLQPLLARHQQT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgagcggtcctggaccctgcccatctcccctcatgaactgcgggttctcgtg
aacggctaccagtcgtggagcgaggcggagctgcgggcgctgctggacacgccgcagcgc
gcgctgttttcgtggatgatcgagcaggggcaagatccggtctttccccccagcggggag
gcgggcgtatggcgttcgcacaccctgatcgccctgattcgcccggatgggggcggctgg
gtgggctgtcttcaagatgcccggcagacctttgctcactgggaggcgcgggcggtgggg
gggcaggtggagctgagctgcaccttggagggtcccccagcggaggtggcctttgaggag
accgaggacgtgatcacaaccgtcgaaaccctcacggcacgattgggaacggtgatgcag
gcccggaccccgccgcccctgcgggtgtggtgcagttggtacagctactaccgggacgtg
acgctcgccgcgatgctggacaatgcccggctcgcccgcgagttggcgctgcctttcgat
gtgtttcagctggacgacggctttcaggcagatttgggcgactggttggagcctagcgcc
tggttcgggggtcatgcgaaggaccttccggcgcagctcaaagaactcggcttccgggct
gggttgtggttggctccctttttggtgggtccgcgctcgcggctgcgggcgcagcagcca
gagtggctgctgcgcggtgcggacggggagccgctgctggcagggcacaactggggcggt
ccctaccacgtgctggacaccacccaccccgaggtgctggcgtggctgcgtgacctggcg
gccactgtgcgggggtggggctacacgtatctgaagctggactttctgtacggggctgcg
ctgcccggggtgcggtatgacccagcggtgagccgggctgcggcctaccggcagggtgtg
caggcgctgcgggatggggcgggcgaggagaccttcctgctggggtgtggggcgcccctt
gcgagcagcatcgggctggtggacgcgatgcggaccgggccggacgtgacgcccttttgg
gacgacgaggcgcggcgggtgctgctgggggacggggcggtgcccagcacgcgtagcgtg
ctgcacacggccctgtcgcgctggtaccagcatgcctggtaccagcctgacccggatgtg
atgattgcccggcgggaactgagtctgctgggggaacacgagcgcggcgccctgcttggc
ctgctcgacgtgattggtggcctgcgggcgagcagcgatcccatccggctgctggacgag
gcgggacgggcgctgctgcggcagagcctgcagctcagccgcccggatcggccccggacg
ctgacgacgagttacggcggagcggtgacccacttcacgcggggcacctttaacctgctg
gatgtgcctgcgggtggcctggcgccgcacagttacagcgcggcccaggttgggggtctc
cagccccttctcgcccgccaccagcagacctag

DBGET integrated database retrieval system