KEGG   Desulfovibrio gigas: DGI_1199Help
Entry
DGI_1199          CDS       T02851                                 

Definition
putative trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
dgg  Desulfovibrio gigas
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DGI_1199
Enzymes [BR:dgg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DGI_1199
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     DGI_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1274191..1277625)
Genome map
AA seq 1144 aa AA seqDB search
MRRNQVRYGSILCPKGAAMSPDRIATWYKDALIYEVHIRSFNDANGDGIGDFIGLTKKLD
YIADLGVTAIWLLPFYPSPGRDDGYDIADYLSINPEYGTMQDFKRFLRQAHLRGLKVITE
LVLNHTSDQHAWFQRARRAPKGSSHRDYYVWSDTPDKYTQARIIFQDTETSNWSWDPVAK
AYYWHRFFSHQPDLNFEHPAVKKEMFKVVDFWLGLGVDGLRLDAVPYLYEAEGTNCENLP
KTFAFLQALRAHVDRRFPNRMLLAEANQWPEDAARYFRPDEAGEACHMAFHFPVMPRLYM
ALRMEDRFPVMDILEQTPAIPESSQWAMFLRNHDELTLEMVTDEERDSMYRSFAPNPRAR
INLGIRRRLAPLVGNERRVIELLHILLFTLPGTPVLYYGDEIRMGDNIYLGDRNGVRTPM
QWSADRNAGFSKANPQQLYLPVIIDPEYHYEAVNVENQESNPASFLWWVRRAIAIRKRHD
SFSRGTLRFVPHANPHVLAYIRSYGDESILVVVNLSRFAQAVRLDLREYKRCTPLELFSG
NPFPSIGQSGEELYTLTLTPHGALLLQLEHSTAERMRAQVEPPLASLAIRPGGFLDRAAK
DVLEERVLPDYLKRRGIITSRHRDLRRLELLEALPMGERDQPVWLLILRWDPPTGPSVFL
HLLVSAHFGQDAQRQLEEHAPLTLCRFLSEPGQEMGMLREGWPDHTPAQTFLRHFAQSRS
IQASRGTVEIQRLHQGPHKEGALQALGGRAVATYESLPQHMARVEMGDLHLKIYGRTEAG
PRPGAEMLQALQGRGPLVPELHGLLTYRAIPGRPVLMAALYRQPHAEACLTDMCRNQLQA
VLEALLSDRASLAQPPAPRRYAAIFTNPEPTPPPAWVPGFVHDLFLRLGEYMACLHTTLA
EPVLGRGFVPEPFSVLYQRSVFQSIQSSVKNACASLDWHGPQQAEEVAALAATLAGRRNE
AIRHLKQLTNLQLDCLKIRIHGDCRLEMLRFTGKELFLADLDGDEARSLSERAIKRNCLR
DMADLERSLWRISHELLTSLRTIRPEDATLLTPWVDAWTRQLFGTCLQAYLQTLDQPARR
HHGGADLLPSRAAEAAFLFQTFLMDRRFREIAIAMEGGPGTSCVAALLASSLAMLDEAAQ
HTPT
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
ctgcgtcggaatcaggtacggtatgggtcgattctctgccccaaaggagccgccatgtcc
ccggaccgtatcgccacttggtacaaagacgccctcatttatgaagtccacatccgcagc
ttcaacgacgccaacggcgatggcatcggcgacttcatcggcctgaccaagaagctggat
tacattgccgacctcggcgtcaccgccatctggctgctgccattctatccgtctcccggt
cgcgacgacgggtatgacatcgccgactacctgagcatcaatcccgagtacgggaccatg
caggacttcaaacgcttcctcaggcaggcccacctgcgggggctcaaggtcatcaccgaa
ctcgtcctcaaccacaccagcgaccagcacgcctggttccagcgcgcccgccgcgccccc
aagggctccagccaccgcgactactacgtctggagcgacaccccggacaagtacacccag
gcccgcatcatctttcaggacaccgagacctccaactggagctgggaccctgtggccaag
gcctactactggcaccggttcttctcccaccagccggacctgaatttcgaacaccccgcc
gtgaaaaaggaaatgttcaaggtggtggatttctggctgggcctgggtgtggacggcctg
cggctggacgccgtgccctacctgtacgaagccgagggcaccaactgcgagaacctgccg
aaaacctttgcgttcctccaggcattgcgcgcccatgtggaccgccggttccccaaccgc
atgctcctggccgaggccaaccagtggcccgaggacgccgcccgctacttccgccccgat
gaggcaggcgaggcctgccacatggccttccactttcccgtcatgccgcggttgtacatg
gccctgcgcatggaggaccgctttccggtgatggacatcctggagcagacgccagccatc
cccgaatccagccaatgggccatgtttctgcgcaatcatgacgaactgacgctggagatg
gtcaccgacgaagagcgcgacagcatgtaccgcagctttgcgcccaacccgcgcgcgcgc
atcaacctgggcatccgccgtcgcctggcgccgctggtgggcaacgagcgacgcgtcatc
gagctgctgcacatcctgctgttcaccctgcccggcacgccagtgctgtactatggcgac
gagatccgcatgggcgacaacatctacctgggcgaccgcaacggcgtgcgcacccccatg
caatggagcgcggaccgcaacgccggcttttccaaggccaatccgcagcaactctatctg
ccggtcatcatcgatcctgaataccattatgaagccgtcaatgtggagaatcaggaatcc
aacccggcatcgttcctctggtgggtgcgccgggccatcgccatccgaaagcgacacgac
agcttcagccgcggcaccttgcgctttgtgccgcatgccaaccctcatgtgctggcctac
atcagaagctatggagacgaatccatcctggtggtggtcaatctttcccgtttcgcccag
gccgtgcggctggatctgcgggaatacaaacgctgcaccccgttggagctgttcagcggc
aacccgttcccctccatcggccagtctggcgaggagctgtacaccctgaccctcacgccc
catggcgcgctgctgctgcaactggagcacagcaccgccgagcgcatgcgtgcccaggtg
gagccgccattggcctcccttgccatcaggcccggcggattcctggaccgtgcggccaag
gacgtgctggaggagcgcgtgctgccggactacctcaagcggcgcggcatcatcacctcc
cgccatcgcgacctgcgacggctggagctgctggaagccctgcccatgggcgaacgcgat
cagcccgtgtggctgctgattctgcggtgggatccccccaccggtcccagcgtgttcctg
catctgctggtgagcgcgcactttggccaggatgcccagcgccagctggaggagcacgcg
ccgctgaccctgtgccggttcctctcggagccgggccaggagatgggcatgttgcgggag
gggtggccggaccacaccccggcccagacatttttgcgccactttgcccagtcgcgcagc
atccaggcctcccgcggcacggtggaaatccagcggctgcaccaaggcccgcacaaggaa
ggcgcgctgcaggcgctgggcggccgcgccgtggccacctacgaatccctgccgcagcac
atggcccgcgtggaaatgggggacctgcacctcaagatctacggccgtaccgaagccggt
ccccggcccggcgcagagatgctccaggccctgcaaggtcgcggtccactggtgccggag
ctgcacgggctgctgacctaccgggcaatcccggggcggcccgtgctcatggccgcgctg
tatcgccagccccatgccgaggcctgcctgacagacatgtgccgtaatcagctccaggcc
gtactggaagccctgctctcggatcgcgcctccctggcccagccgccggctccgcgccgc
tatgcggccatctttaccaatcccgaacccaccccgccgccggcctgggttcccggtttc
gtccatgatctgttcctgcggctgggcgaatacatggcctgcctgcacaccaccctggcc
gaacccgtcctgggcagggggtttgtgccggaaccgttctcggtcctctatcagcgttcc
gtttttcagagcatccaaagcagcgtgaaaaacgcctgcgcctcgctggactggcatggc
ccgcagcaggcggaggaggttgccgccctggctgccaccctggccggccggcgcaacgag
gccatccgccacctgaaacagctgacgaatctgcagctggattgtctgaaaatccgcatc
catggcgattgccggctggagatgctgcgcttcaccggcaaggagctgttcctggcagat
ctggacggcgacgaggccaggagcctttccgaacgcgccatcaaacgcaactgcctgcga
gacatggcggacctggagcgctccctgtggcgcatctcccacgagttgctgacaagcctg
cgcaccatccggcccgaggacgccacgctgctgactccctgggtggacgcctggacccgg
cagctcttcggcacctgcctgcaggcctatctgcagaccctggaccagccggcccggcgc
caccatggcggcgcggatctgctgcccagccgggccgcggaggcagcgttcctgttccag
acattcctgatggaccggcgtttccgggagatcgccatcgccatggaaggcggccccgga
acctcatgcgtggcggcgctgctggcttccagcctggccatgctggatgaggcggcgcaa
cacacgccaacatag

DBGET integrated database retrieval system