KEGG   Desulfovibrio gigas: DGI_2137Help
Entry
DGI_2137          CDS       T02851                                 

Definition
putative alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dgg  Desulfovibrio gigas
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dgg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DGI_2137
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DGI_2137
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DGI_2137
Enzymes [BR:dgg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DGI_2137
Exosome [BR:dgg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DGI_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2230358..2231863)
Genome map
AA seq 501 aa AA seqDB search
MTRLARVVCMAALAACVALPAAAAPAAQQAKYIFLFIGDGMGMPQRTAAEQFQGKPLVMN
TFPVQGIAATDAVDRFITDSGAAATSMASGVKTLVEKIGVNTALKPVKTVAEMAKDRGMK
VAILSSVSIDHATPACFYAHVPSRGGYHEIDIALAKSGFDFFGGGDMRDPDGARAKKKDE
SYQPLGDAVAIAKENGYKIITSKQDFMALKPSDGKVIAWNDWRQDAGALPYQIDTRAEDI
NIAEFTEKAIEMVDNPKGFFMMVEGGKIDWACHANDAAAAIHDTLVFDQAIQKAVDFAKK
HPNETLILVAGDHECGGLTLGYAGTKYDTDFEVLGSQKISFQKFDAEIFKDFQGDFDAAK
ALITEHFGLKFEGDAKKDVLVLSEYQIKLLQDAFEATKMGKKERDANEETYVLYGGYNPL
GVAITHVLNQKAGLSWTSFSHTGVPISVSAMGAGADKFTGSYHLADIALRTMEVMGEPGK
PVIMESAAAAPVAVPAAVAAK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcctggcccgtgtcgtttgcatggcggctctggccgcctgcgtggccttgcct
gccgctgcggcccctgctgcgcagcaggccaagtacatctttctgttcattggcgacggc
atgggcatgccccagcgcactgccgccgaacagttccagggcaagcccctggtcatgaac
accttcccggtgcagggcatcgccgccacggatgccgtggatcgcttcatcaccgattcc
ggcgccgccgccacctccatggcttccggcgtgaagaccctggtggaaaagatcggcgtg
aacaccgccctcaagcccgtgaagaccgtggcggaaatggccaaggatcgcggcatgaag
gtggccatcctctcctccgtgtccatcgaccacgccaccccggcctgcttctacgcccat
gtgcccagccgtggcggctaccatgaaatcgacatcgccctggccaagtccggcttcgat
ttcttcggcggcggcgacatgcgtgaccccgacggcgcccgcgccaagaagaaggacgaa
tcctaccagcccctgggcgacgccgtggccatcgccaaggaaaacggctacaaaatcatc
accagcaagcaggacttcatggccctgaagcccagcgacggcaaagtcatcgcctggaat
gactggcgccaggacgccggggccctgccctaccagatcgacacccgcgccgaagatatc
aacatcgccgaattcaccgaaaaagccatcgaaatggtggacaaccccaagggcttcttc
atgatggtggaaggcggcaagatcgactgggcctgccacgccaacgacgccgccgcggcc
atccacgacaccctggtgttcgatcaggccatccagaaggctgtggacttcgccaagaag
caccccaacgagaccctgatcctcgtcgccggcgaccatgaatgcggcggcctgaccctg
ggctacgccggcaccaagtacgacaccgacttcgaagtgctgggctcccagaaaatctcc
ttccagaaattcgacgccgaaatcttcaaggacttccagggcgacttcgacgctgccaag
gccctcatcaccgaacacttcggcctgaagtttgaaggcgacgccaagaaggacgtgctg
gtcctttccgaataccagatcaagttgctgcaggacgccttcgaagccaccaagatgggc
aagaaggaacgcgacgccaacgaagaaacctacgtcctctacggcggctacaatcctctg
ggcgtggccatcacccacgtgctgaaccagaaggccggcctgtcctggacctccttctcc
cacaccggcgtgcccatctccgtgtccgccatgggcgccggcgccgacaagttcaccggc
tcctaccacctggccgacattgccctgcggaccatggaagtgatgggcgagcccggcaag
cccgtgatcatggaatccgctgctgctgcccccgtggccgtgcctgccgccgtggccgcc
aagtag

DBGET integrated database retrieval system