KEGG   Desulfovibrio gigas: DGI_2304Help
Entry
DGI_2304          CDS       T02851                                 

Definition
putative glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dgg  Desulfovibrio gigas
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dgg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DGI_2304
Enzymes [BR:dgg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     DGI_2304
Exosome [BR:dgg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DGI_2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2418386..2420344)
Genome map
AA seq 652 aa AA seqDB search
MELITHPTPIEPFDLYLFGRGEHWDIYRILGAHPHEQEGLAGYRFAVWAPSAKEVHLVCE
SNDWRWGELPLFPVGVSGIWAAFVPGMPKGVLYKYGILQTSDRIIYKTDPYGQCTELRPG
VACKTWTLEGYAWQDDAWMQRRQEAGLLLDKPMSVYEVHAGSWRKHENAPGRGFYSYREL
ADTLVPYVKEMGFTHIQFMPLAEHPLDESWGYQTSHHYAPTSRFGEPDDLRHLIDRCHQE
GIGVLLDWVPGHFPKDEWCLGRFDGEACYEHADPRQGEHPDWGTYIFNYGRHEVRNFLLA
NALYWLKEFHIDGIRIDAVASMLYLDYSRKDGEWIPNIYGGNENLEAIDFLKELNRVVHE
QFPGVITVAEESTAWPGVSRPLYTGGLGFTFKWNMGWMHDTLLYFSKESVHRQFHHNNLT
FSMLYAFSENFVLPLSHDEVVHGKKALLAKMPGDMWQQFANARAMLSYVYAHPGKKLLFM
GSEIGQWNEWDAGKELDWMLLEYPTHQGLQRTVKELNRMHCEEPAMHRHDHDWGGFEWVD
LSDYTSSVLSFLRKAPCTWQNEKQCAAGRPLLWVFNFTPVVRTNYAIGCPYPGVWKELFN
SDSHYYGGSNVGNDGGVMAHKADLGTWPYYLELTLPPLAAMAFAPERWQPQE
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggaattgattacgcatcccacccccattgagccgttcgacctgtatctctttggtcgc
ggggagcactgggatatttatcgcatcctgggagcacatccgcacgagcaggaagggctg
gcaggctaccgctttgccgtctgggcgcccagcgccaaggaagtgcatctggtgtgcgaa
tccaacgactggcgctggggcgaattgccgctgttccccgtgggcgtgtccggcatctgg
gccgcctttgtaccgggcatgccaaaaggcgtgctgtataaatatggcattctccagacc
agcgaccgcatcatctacaaaacggacccgtacggccagtgcaccgagctccggcccggt
gtggcctgcaaaacctggacgctggaaggctacgcctggcaggacgatgcctggatgcag
cgccgtcaggaggccgggctgctcctggacaagcccatgagcgtgtacgaggtgcatgcc
ggttcctggcgcaagcacgaaaacgccccgggccgcggcttttattcctaccgggaactg
gcggacacgctggtgccctatgtcaaggaaatgggcttcacccacatccagttcatgccc
ctggccgaacatcccctggatgaaagctggggctaccagacctcccaccactacgccccc
acttcccgcttcggcgagccggacgacctgcgtcatctcatcgatcgctgccatcaggag
ggcatcggggtgctgctggactgggtgcccggccattttcccaaggatgaatggtgcctg
gggcgttttgacggcgaggcctgctacgagcacgccgacccccgccagggcgaacacccg
gactggggcacgtacatcttcaattacggccggcatgaggtccgcaacttcctcctggcc
aacgccttgtactggctcaaggaattccacatcgacggcatccgcatcgatgccgtggcc
agcatgctgtacctggactactcccgcaaggacggtgagtggattcccaacatctacggc
ggcaacgaaaacctggaagccatcgacttcctgaaagaactcaaccgggtggtgcacgag
cagttccccggcgtcatcaccgtggccgaggaaagcacggcctggccgggggtgtcgcgc
ccgctgtacaccggcggcctggggttcaccttcaagtggaacatgggctggatgcacgat
accttgctgtatttctccaaggagtccgtgcatcggcagttccatcacaacaatctcacc
ttctccatgctgtacgccttttcggaaaacttcgtgctgccgctttctcacgatgaggtg
gtgcacggcaaaaaggcgctcctggccaagatgcccggagacatgtggcagcagttcgcc
aatgcccgggccatgctctcgtacgtgtacgcgcatccgggcaagaagctgctgttcatg
ggctcggagattggccagtggaacgagtgggatgccggcaaggaacttgactggatgctg
ctggagtaccccacgcaccaggggctgcagcgcaccgtcaaggaacttaatcggatgcac
tgcgaagagccggccatgcaccgccatgaccacgactggggcggcttcgagtgggtggat
ctttccgattacacgtcgtccgtgctcagttttctgcgcaaggcgccctgcacctggcag
aacgagaagcagtgcgccgccggccggccgctgttgtgggtcttcaacttcacgcccgtg
gtgcgcaccaattacgccatcggctgcccgtatcctggtgtctggaaggaattgttcaac
tccgacagccactactacgggggctccaatgtgggcaacgacggcggcgtgatggcccac
aaggccgacctgggcacctggccctattacctggaactgaccctgccccccctggcggcc
atggcctttgcgccggagcgctggcagccgcaggagtag

DBGET integrated database retrieval system