KEGG   Desulfovibrio gigas: DGI_2638Help
Entry
DGI_2638          CDS       T02851                                 

Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dgg  Desulfovibrio gigas
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dgg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2758909..2760405)
Genome map
AA seq 498 aa AA seqDB search
MQLRGSGILLHVTSLPSAHGIGDLGPQAHRFAVLLREQGLRFWQVLPMGPTSPAIGNSPY
SSCSAFAGNPLCIDLADLVARGWLDATLLQHAPAFDTARVQYEAVEAFKERCLRAAFAVA
EPGLSDHQDFCRFVEDAAWLEDYALFVTLKARYCGAVWTDWPEPFRDRQSAALAAWRQEA
DREIRYQQFVQFCFADQWQRLRRVCARNCVQLVGDVPIYVTFDSADVWSHPTLFKLDDQR
APVAVAGVPPDYFSETGQLWGNPVYDWAAAAATGYAWWVERMGHAMAMYDLVRLDHFRGF
AGYWEVPAGEKTAINGEWVDAPGMAFFAELLKHLPSLRILAEDLGVITPDVRELKKAYGF
PGMKILQFAFGPGIGENPDAPHNHEEHCVVYTGTHDNNTTQGWWLDETSPEDRLRLRRYT
GRFDEINEPHWLMIQIALASVARTAIVPMQDLLGLGREARMNTPGLANGNWTWRCTQAQL
ESGVLKRYGDLAALFGRG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttcgcggcagcggtatcctgcttcatgtcacgtccttgccctcggctcacggc
attggcgatctcggccctcaggcacaccgcttcgctgttctgctgcgcgaacagggattg
cggttctggcaggtgctgcccatggggcccaccagcccggccatcggcaactcgccgtat
tcgtcgtgctccgcgtttgccggcaaccccctgtgcatcgatctggccgatctcgtcgcc
cggggctggctcgatgccaccctgctgcagcacgccccggccttcgataccgcgcgtgtg
cagtacgaggccgtggaagccttcaaggagcgctgcctgcgcgccgcctttgccgtggcg
gagcccggcctttcggatcatcaggatttttgccgctttgtggaagacgccgcctggctg
gaggactacgcgctcttcgtcaccctcaaggcccgctattgcggcgccgtgtggacggac
tggcccgaaccattccgggatcgtcagtctgcagccctggcggcctggcggcaggaagct
gaccgggagatccgctatcagcagttcgtgcagttttgctttgcagaccagtggcagcgc
ctgcgccgcgtgtgcgccaggaattgcgtgcaattggtgggggatgtgcccatctacgtg
accttcgattcggcggatgtctggtcccatccgacgctgttcaagctggatgatcagcgc
gcgccggtggccgtggccggggttccgccagactatttcagcgaaaccggccaattgtgg
ggaaatcctgtctatgactgggccgccgccgccgccacaggctatgcttggtgggtggag
cgcatgggccacgccatggccatgtacgatctggtgcggctggatcactttcgcggcttt
gccggctattgggaagtgccggccggggagaagacggccatcaacggcgagtgggtggac
gccccgggcatggccttctttgccgagttgctcaagcatctgccaagcctgcgtattctg
gccgaggatctgggcgtcatcaccccggatgtgcgcgagctgaagaaggcctacggtttt
cccggcatgaagatcctgcagttcgcctttgggccgggcattggcgagaaccccgacgcc
ccgcacaatcacgaggaacactgcgtggtgtacaccggcacccacgacaacaacaccaca
cagggctggtggctggacgagaccagtcccgaagaccgcctccgcctgcgtcgctacacc
gggcggttcgacgagatcaacgagccgcattggctgatgatccagatagccctggccagc
gtggcccgcacggccatcgtgcccatgcaggatctgctgggcctgggccgagaggcccgc
atgaacacgccggggctggccaacggcaactggacctggcgttgtacccaggcgcagctg
gaatccggtgtgctgaagcggtacggcgatctggcggcgttgttcggcaggggatga

DBGET integrated database retrieval system